KEGG   Thermoplasma acidophilum: Ta0079Help
Entry
Ta0079            CDS       T00037                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tac  Thermoplasma acidophilum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tac00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(78316..79359)
Genome map
AA seq 347 aa AA seqDB search
MDGLIIPRRGFYGGSNGRFQFEIFSEKAPPVEHEEITEGGKKKYIVWADQKMFRDLMEFY
SMYPGHEDAASAAVFKALDDKPSIPKIMGIVNATPDSFYPGSRVLGHSDLVFKMIDEKPD
ILDIGAESTRPGSKGIDPSTELERLIPVVKMVRDYSDIPISIDSRHPSVIDGLIKYEINY
INDISGFTDRKMIDIAKDSGLNCIVMHMRGTPENMQSLTAYDDIIYDVAGFLANRADELL
RNDVGFDRIILDPGIGFAKDIKGNVDILRNIKSFNVGFPLLVGTSRKTFIGTITGQNVEN
RLAGTIGTSIYLAENRVSILRVHDVKENRDALTTYLVLASQGMGSNT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggacggtctgatcatcccgcgcaggggattctatggtggatccaatgggcggttccag
tttgagatattttccgagaaagccccacctgtagaacacgaggagatcactgaaggtgga
aagaaaaagtacattgtgtgggcagatcagaagatgttcagggatctgatggaattctac
tccatgtatccaggacacgaagatgctgcctctgctgccgtattcaaagcgctggatgac
aagccatcaatacccaagataatgggcatagtgaacgccacgccggattcgttttatccg
ggaagccgcgttctcggacactcagacctcgtattcaagatgatagatgagaaacccgat
atactagacataggtgctgagagcacaaggcctggtagcaaggggatcgatccatccact
gaactcgagaggctgattcccgtggtcaagatggtcagagattattcagacataccaatt
tcgatagattccagacatccatctgtgatcgatggcctcataaaatatgaaataaactac
ataaacgatatatcaggattcaccgacaggaaaatgatagatattgcaaaggattccggg
ctgaactgcatagtgatgcacatgcgcggcacgccggaaaacatgcaaagcctgaccgcg
tacgatgacataatttacgatgtggccggattcctcgccaacagggccgatgaactcctg
aggaatgacgttggtttcgatcggataatacttgatcctggaataggcttcgccaaggac
ataaagggaaatgtggatatactcagaaacataaagagcttcaatgtcggattcccattg
ctcgttggtacctccaggaagacgttcataggaaccataaccggccagaatgtcgagaac
aggcttgctggaacaataggcacgagcatatatctagccgagaacagggtatcaatactg
agagtacacgacgtgaaggagaacagggatgcactgaccacctacctggtccttgcatct
caaggaatgggcagcaacacttga

DBGET integrated database retrieval system