KEGG   Thermoplasma acidophilum: Ta0079Help
Entry
Ta0079            CDS       T00037                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tac  Thermoplasma acidophilum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ta0079
Enzymes [BR:tac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ta0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(78316..79359)
Genome map
AA seq 347 aa AA seqDB search
MDGLIIPRRGFYGGSNGRFQFEIFSEKAPPVEHEEITEGGKKKYIVWADQKMFRDLMEFY
SMYPGHEDAASAAVFKALDDKPSIPKIMGIVNATPDSFYPGSRVLGHSDLVFKMIDEKPD
ILDIGAESTRPGSKGIDPSTELERLIPVVKMVRDYSDIPISIDSRHPSVIDGLIKYEINY
INDISGFTDRKMIDIAKDSGLNCIVMHMRGTPENMQSLTAYDDIIYDVAGFLANRADELL
RNDVGFDRIILDPGIGFAKDIKGNVDILRNIKSFNVGFPLLVGTSRKTFIGTITGQNVEN
RLAGTIGTSIYLAENRVSILRVHDVKENRDALTTYLVLASQGMGSNT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggacggtctgatcatcccgcgcaggggattctatggtggatccaatgggcggttccag
tttgagatattttccgagaaagccccacctgtagaacacgaggagatcactgaaggtgga
aagaaaaagtacattgtgtgggcagatcagaagatgttcagggatctgatggaattctac
tccatgtatccaggacacgaagatgctgcctctgctgccgtattcaaagcgctggatgac
aagccatcaatacccaagataatgggcatagtgaacgccacgccggattcgttttatccg
ggaagccgcgttctcggacactcagacctcgtattcaagatgatagatgagaaacccgat
atactagacataggtgctgagagcacaaggcctggtagcaaggggatcgatccatccact
gaactcgagaggctgattcccgtggtcaagatggtcagagattattcagacataccaatt
tcgatagattccagacatccatctgtgatcgatggcctcataaaatatgaaataaactac
ataaacgatatatcaggattcaccgacaggaaaatgatagatattgcaaaggattccggg
ctgaactgcatagtgatgcacatgcgcggcacgccggaaaacatgcaaagcctgaccgcg
tacgatgacataatttacgatgtggccggattcctcgccaacagggccgatgaactcctg
aggaatgacgttggtttcgatcggataatacttgatcctggaataggcttcgccaaggac
ataaagggaaatgtggatatactcagaaacataaagagcttcaatgtcggattcccattg
ctcgttggtacctccaggaagacgttcataggaaccataaccggccagaatgtcgagaac
aggcttgctggaacaataggcacgagcatatatctagccgagaacagggtatcaatactg
agagtacacgacgtgaaggagaacagggatgcactgaccacctacctggtccttgcatct
caaggaatgggcagcaacacttga

DBGET integrated database retrieval system