KEGG   Thermoplasma acidophilum: Ta0313Help
Entry
Ta0313            CDS       T00037                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta0313
   01230 Biosynthesis of amino acids
    Ta0313
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta0313
   00051 Fructose and mannose metabolism
    Ta0313
   00562 Inositol phosphate metabolism
    Ta0313
Enzymes [BR:tac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ta0313
Exosome [BR:tac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ta0313
  Exosomal proteins of bladder cancer cells
   Ta0313
  Exosomal proteins of melanoma cells
   Ta0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334841..335491
Genome map
AA seq 216 aa AA seqDB search
MYTAIVNLKTYREATGANFTRFMEKFEPVQGKFELIFSPSLLDLEKAAKCGKFRFFAQHV
DAEPYGAYTGHVPMDMMIDLGITGSILNHSERRLPRDTIINTLKKASKLDFTIVLCVENA
EEAKYFREYEPDFIAYEPRDLIGGDVSVSTAKPEIIEDIVKIYEGTGTSVLVGAGIKTGE
DVRRSIGLGARGILVASGVVKSADPTKSLNSLIELK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtacacagccatagtcaacctgaagacctacagggaagcgactggtgcaaatttcacg
cgcttcatggaaaagttcgagcctgttcaaggaaaatttgaactgatattttctccatcg
ttgcttgatcttgaaaaggctgccaaatgcggaaagttcaggttctttgcgcagcacgtt
gatgctgagccgtatggagcatacacgggccatgtaccgatggatatgatgatcgatctg
ggcataactggatcgatactcaaccactctgagaggcggctgcccagggatacgataata
aacactcttaagaaggccagtaagttagacttcaccatagttctgtgtgtggagaatgcg
gaggaagccaaatatttcagggaatatgagccggatttcatagcctacgagccaagggat
ctgatcggcggggatgtttccgtatcaacggcaaaaccggagatcatagaagacattgtg
aagatatacgaaggtacaggcacatcggttctggttggagcaggaataaagaccggcgag
gatgtgaggcgatccataggcctgggcgctaggggcatactggtagcaagcggggtagta
aaatcggcagaccctacaaaatcgttaaattcattaatagagttaaaatag

DBGET integrated database retrieval system