KEGG   Thermoplasma acidophilum: Ta0421Help
Entry
Ta0421            CDS       T00037                                 

Definition
acetyl-coenzyme-A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta0421
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta0421
   00620 Pyruvate metabolism
    Ta0421
   00640 Propanoate metabolism
    Ta0421
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ta0421
   00680 Methane metabolism
    Ta0421
Enzymes [BR:tac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ta0421
Lipid biosynthesis proteins [BR:tac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ta0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446656..448599)
Genome map
AA seq 647 aa AA seqDB search
MESEKGTLPMNEVYNPGMNVYSEIYRKSLEDPENFWAKQAEILTWYSKWNKILDDSKKPF
YRWFVGGKLNVSYNAVDRHLEQHRRNKAAYIWVGENGEEKIVTYDGLYRRINNLAKALLN
LGIKKGDRIVLYLPMIIEAPVAMLAAARIGAVFSFVFAGFGAGALAERINDSKAVLLITA
DGGFRNGKVVELKKIADEALEMTSTVRNVIVIKHARNDVNMVEDRDIWYHEIVGDSHTYV
EPEHMDANDPLFILYTSGTTGKPKGAVHSTGGYSVWVASTLKWAFNPDEDDRWWCAADIG
WITGHSYIVFAPLILGLTSIMYEGSITYPEPDRLWEIIEKYRVNILYTSPTAIRTLMKFG
EKYPQRHDLSTLKVLGTVGEPINPAAWKWYYEIIGNSRCPIIDTYWQTETGGFMIAPQRG
LGLPPLKPGSATFPLPGVDPAILDDAGKEVRTGEKGYIVFRRPWPGMLMTVNNDDERYVK
TYFSKFPGYYYCGDYAVKDEDGYYWLLGRSDEVMNVSGHRLGTIEIEDAIVATGLAVEAA
VFGKPDPVKGEAISAFVVPKDANADRHELISEIRKRIRADLGPIYVPDEIRIVKLLPKTR
SGKIMRRVVKAVALNQIPGDLTTLEDSTSVDEIKSAIEAFKGEAGGE
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcgaaaagggaacattacccatgaacgaggtctacaaccccggcatgaacgtg
tacagcgagatatacaggaaatccctggaagatcctgagaatttctgggcaaaacaggcc
gagatactgacatggtattccaaatggaacaagatcctcgacgattcaaagaagccgttt
tacagatggtttgtgggcggaaagctcaacgtgtcgtacaacgcagttgacaggcacctg
gagcagcacaggaggaataaggccgcatacatatgggttggcgaaaatggtgaagaaaag
atagtgacgtacgatggactttacaggaggataaacaacctggccaaagccctcctgaac
ctcggaataaagaagggagacaggatagtactgtacctgcccatgataatcgaagcgccc
gttgccatgctggccgcggccaggataggtgcagtattctctttcgtcttcgcaggcttc
ggtgcaggtgcactggcagagaggataaacgattcaaaggccgtactgctgataactgca
gatggaggtttcagaaacggcaaggtggtggagctaaagaagatagcggatgaggccctt
gagatgacctccacggtcagaaacgtgatcgtcataaagcatgccaggaatgacgtgaac
atggttgaggatcgggatatctggtatcatgagatcgttggtgattcgcatacgtacgtt
gagccggaacatatggacgcgaacgatccgctcttcatcctttacacctctggaaccact
ggaaaacccaaaggagctgtgcacagcaccgggggctattccgtatgggttgccagcacg
ctgaagtgggctttcaatcctgatgaggatgacagatggtggtgcgctgcagacataggc
tggataaccgggcacagctacatagtattcgctcccttgatccttggcctgacgagcatc
atgtacgagggatcgataacctatcccgaacctgacaggctatgggagatcatagaaaaa
taccgcgtgaacatcctttacacctcccccacggctataaggacgctgatgaagttcgga
gagaagtacccgcagaggcatgatctgagcaccctgaaagttctcggaacggttggagaa
cccataaatccggctgcctggaaatggtactacgagatcatcggcaactccaggtgcccg
ataatcgatacgtactggcagacggagaccggaggtttcatgatcgcaccgcagagggga
ctcggcctgccaccattgaagcctggttctgcgacttttccgcttcctggcgtagatcct
gcaatacttgatgacgcgggaaaggaggtgcgtaccggcgagaagggttacatagtcttc
aggagaccgtggccaggtatgctgatgaccgtcaacaacgacgacgagagatacgtaaaa
acatacttctccaagttccccggctactattactgcggcgactatgcggtgaaggacgaa
gatggctactactggctcctgggcagatccgacgaggtcatgaacgtatcagggcacagg
cttggtacgatcgagatcgaggatgccatagtagccacaggccttgccgttgaagctgcc
gtcttcggaaagcccgatccggtaaagggcgaggcaatatcggcattcgttgtacccaag
gacgcaaacgccgacaggcacgaactcatctcggagatacgcaagaggataagggctgat
cttggcccgatatacgttccggacgagatcaggatcgtgaaactgttgccgaagacgagg
agcggcaagataatgaggagggtcgtgaaagctgtggcgctgaaccagatacctggcgat
ctaacgactctggaggattccacctctgtggacgagatcaagagcgcaattgaagccttc
aagggagaggccggaggtgagtga

DBGET integrated database retrieval system