KEGG   Thermoplasma acidophilum: Ta0568Help
Entry
Ta0568            CDS       T00037                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta0568
   00030 Pentose phosphate pathway
    Ta0568
   00051 Fructose and mannose metabolism
    Ta0568
   00052 Galactose metabolism
    Ta0568
   00500 Starch and sucrose metabolism
    Ta0568
   00520 Amino sugar and nucleotide sugar metabolism
    Ta0568
  Nucleotide metabolism
   00230 Purine metabolism
    Ta0568
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ta0568
Enzymes [BR:tac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Ta0568
    5.4.2.8  phosphomannomutase
     Ta0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598063..599424
Genome map
AA seq 453 aa AA seqDB search
MTLFLIMADQRLFGTNGIRGIPNDDLTVDFAIRVGKSIGMFVSGDVAVGRDTRISGDMIA
SSVLAGLMATGHNIIDLGILPTPALQYYCKNHALYGVMITASHNPPQYNGIKVIDRDGTE
IERPSEEKIENIYSTGSFNMVRWEDVGRIRYVSDAIDQYIDGVLSKVDVRRIKERRFRVL
VDTGNGAAYASTPKLLEKLGCSVVTLNANPDGRFTSRNAEPKPENLKELMALMANGNFDL
GIAHDGDADRVVFIDERGNFIDGDKSLALLVKNFASASDIVVTPVSSSDTISDVCSAIGA
TIIRTKVGAPIVARTMIQNGAVIGGEENGGVIYGKHQYCRDGAMTLSLMLDLMARSNRKI
SELIRELPPYFLEKRQIERTVDWGLLERELRKGEKVDTTDGIKIIKDDGWILIRPSGTEK
ILRVYAESTDMAMAKKYADQYVAKIRDLQEKLG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacgctattcttgatcatggcagatcagaggctattcggtaccaatggaataaggggt
ataccaaacgatgatctcaccgttgattttgcgatccgggttgggaagagcataggcatg
ttcgtatctggcgacgttgccgtcggaagggatacacggatcagcggcgatatgatagcc
tcttccgttctggctggcctcatggccacaggccacaatataatagatcttggcatactt
cccacgcctgcacttcagtactactgcaagaaccatgcactgtacggagttatgataacc
gcgtcgcacaatccgccgcagtacaatgggataaaggtaatagatagggatggcactgag
atagaacgcccctctgaggaaaagatagaaaacatatacagcaccggatcgttcaacatg
gtcaggtgggaggacgtaggcaggataagatacgtgagcgatgccatcgatcagtacata
gatggcgttttatcaaaggttgatgtcaggagaataaaagaaagaagattcagagtgctt
gttgatacagggaatggcgcggcctatgcctccactcctaagctcctggaaaagttagga
tgcagcgtcgttacgctcaatgccaaccctgatggcagattcacttcgaggaatgcagag
ccgaagcccgaaaacctcaaagaactcatggcgctcatggcgaatggaaattttgatctt
ggaatagcccacgatggcgatgctgacagggttgtgttcatagatgaaaggggaaacttc
atagacggtgataagagcctggccctcctggtaaaaaacttcgcctctgccagcgatata
gttgttacaccagtcagctcatcggacaccatatcagatgtgtgttcggcaataggcgcc
acgatcatacggacgaaggtcggtgcgccgatagttgcaaggacgatgatacagaacggt
gctgttataggaggcgaggaaaacggaggcgtcatctacggaaaacatcagtactgcagg
gacggcgcgatgacactctcactgatgctggatcttatggccaggagcaacaggaagata
tcagaactgatacgtgaacttccaccgtatttcttggagaagagacagatagaacggact
gtggactggggcttgctggagagagagcttcgaaagggggagaaggtggatactacagat
ggcataaagatcataaaggatgatgggtggatactcataaggccatctggtacagaaaaa
atactaagggtgtatgcagaatccacggatatggccatggcaaaaaaatatgccgatcag
tacgtggcgaagataagggatctgcaggaaaaattgggatga

DBGET integrated database retrieval system