KEGG   Thermoplasma acidophilum: Ta0573Help
Entry
Ta0573            CDS       T00037                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00860  Porphyrin and chlorophyll metabolism
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
tac01120  Microbial metabolism in diverse environments
Module
tac_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ta0573
Enzymes [BR:tac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ta0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAC11713
UniProt: Q9HKM4
Position
602933..603610
Genome map
AA seq 225 aa AA seqDB search
MKIFVLSIRPEEKAQRTGGACFDILNVPVTRLEPIPVDYTDLIRSGVDCVAFTSSYGVRL
FFKNAPVKNFRYFGIGKSTCEEVRKYGYDCEYPEKMDSEGLADMIISHCSGRKVALIRSA
NANEIVNEKIMGHVDFIDLRNYRAVNTNVDLTPYMAKEECMGIIVTSSMEAKIAMPAIKA
TGKPVYSIGSVTTKTLEEAGIHPAISGNSDFVDLVEKIKKYLCLV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttcgtcctgtccataaggccggaggagaaggcccaacgtaccggcggggcg
tgtttcgatatactgaacgttccagttacgagactggagccgataccagtcgactacacc
gatctcatcagatcaggcgtagattgcgtggcgttcacaagctcctacggggtgcgccta
ttcttcaaaaatgcgcctgtgaaaaatttcagatacttcgggataggaaagtccacgtgc
gaggaggtgcgcaaatacggatacgactgcgaatacccagagaagatggattcggagggc
ctcgccgatatgataatttcacactgctcgggcaggaaggtagcactcataaggagcgca
aacgcgaacgagatcgtcaacgagaagatcatgggacatgttgatttcatagatttaagg
aattacagagccgttaataccaacgtggatctcacgccatacatggctaaagaggaatgc
atgggcatcatcgtcacatcatcaatggaggctaaaatcgccatgcccgcaataaaggcc
actggaaagccggtttactcgatcggaagtgtcacaactaagacactagaggaggctgga
attcacccagcaatatccggcaactcggatttcgtagatctggttgaaaaaataaaaaaa
tacctatgcttggtttaa

DBGET integrated database retrieval system