KEGG   Thermoplasma acidophilum: Ta0576Help
Entry
Ta0576            CDS       T00037                                 

Definition
protoporphyrin IX magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tac  Thermoplasma acidophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(605037..606890)
Genome map
AA seq 617 aa AA seqDB search
MFVMEKVLFPFSAVVDEDDLKMALILNAIDQRIGGVLIMGPKGVAKSTIARSLTDLLPDI
DVVKDCPFKCDPHDPSSMCDECIKKYRDGTIVSEKRKIPFVNMPVTATLDRVVGSLDIKR
AIDEGLRALQPGLLAEANRGIIYIDEVNLLDDSVVDSILDSAASGINVVEREGVSVTHPA
RFILIGTMNPEEGDLRPQLKDRFGLSVTAVQPSDPEELIEISNRVEEFDRDPEAFRRKYE
KIQNEIRNRIMRARSLLPSVVIDEDLKRFIAEVVIKLQAGNRAMITAVKASKAIAAFNGR
DRVNIDDVKEALNLVLKHRVKDSAMIRGTIEKESRDLSTRSVEAGPHSGYEEGSESSGRR
DMKAGNGKDEEKDVEVSAAFDEESNRSGRTGNADIFRILDQNRPGDHFDYRASLVNMIMN
GRRRMKYEDLAFVSSRSRASIPVILAVDASRSMETMHRIALARGIARSFLHSAYRMRVKL
SYITFYGTESHLMVEPTRNLDLIDREISRTVPQGKTPIPAALKMMYDISSRYRQRTVSIM
ITDGRANVPLGNDVTHDVREWSAKLGTRSDLFLISSTMGSERFMPSYNEDICRYSGGQLI
EMDGNGHIALYSGYRRY
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtgatggaaaaggttctatttcctttcagtgcagtggtggatgaagatgacctg
aagatggctctcatactgaacgctatcgatcagcgaataggtggagtgctaataatgggg
ccaaagggagtggcgaagtctacaatagcaagatctttgaccgatctgcttccggacata
gacgttgtcaaggactgccccttcaagtgcgacccccacgatccctcatcgatgtgcgat
gaatgcataaagaagtatcgcgacggtaccatcgtctccgaaaagagaaagatccccttt
gtaaacatgcctgtgacggcaacgctggacagagttgtaggcagtcttgatatcaagcga
gcaatagatgagggcctgcgcgcattgcagccaggtctccttgctgaggccaaccgcggc
ataatatacatagatgaggtcaacctcctggatgattccgtcgtggattccatccttgat
tctgcagcttccggtataaatgtggtggagagagaaggagtcagcgtgacgcatcctgca
cgcttcatactgattggcacaatgaatccagaggagggtgatctcaggccccagcttaag
gatcgctttgggctttccgtaaccgctgtgcagccatccgatcctgaggagctcatagag
atatcaaacagagtcgaggagttcgacagggatccggaagctttccgcaggaaatatgaa
aagatccagaatgagataagaaacaggataatgcgagcaagatcgctgctgccatccgtt
gtaatcgatgaagatctgaagcgtttcatagccgaggttgtgatcaaattgcaggctgga
aacagggcaatgatcacagcggtcaaagcttccaaggcgatcgctgcattcaatggaaga
gatcgtgtgaacattgatgacgttaaggaagcgctgaaccttgttctgaagcatcgtgtc
aaggacagcgcgatgatcaggggcacaatagagaaggaatcaagggatctttccacgaga
tctgttgaagccggcccacacagcggatacgaagaaggaagcgaatcaagcggcagaagg
gatatgaaggctggaaacgggaaggacgaagaaaaggatgtagaggtatcagccgcgttc
gatgaagaatcaaacagaagcgggagaaccggaaatgctgacatattccggatactggat
cagaaccggcctggggatcattttgattacagggcgagccttgtcaacatgataatgaac
ggccgccgcaggatgaaatatgaggatctggcattcgtatcatccagatcaagggcatcc
ataccggtgatacttgccgttgacgcaagcagatccatggaaaccatgcacaggatcgcc
ctcgcaaggggcatcgcccgatcattccttcactccgcatacaggatgcgtgtgaaactt
tcctacataaccttctatggaactgagagccacctcatggtggagccaacaagaaatcta
gatctgatcgatagggaaatatcaagaaccgttccgcaggggaagacgcctatacccgct
gcgctgaagatgatgtacgacatttcgagcaggtacaggcagaggacggtatcgataatg
ataacagacggccgtgcaaacgtgcctcttggcaacgacgtaacccatgatgtaagagaa
tggtccgccaagctcggaaccaggagcgatctcttcctcatatcttcaaccatgggaagc
gagagattcatgccgtcttacaacgaagatatatgcaggtattccggtggacagcttata
gagatggacggaaatggccatatcgctctatactccggctacagaagatactga

DBGET integrated database retrieval system