KEGG   Thermoplasma acidophilum: Ta0626mHelp
Entry
Ta0626m           CDS       T00037                                 

Definition
2-oxoacid-ferredoxin oxidoreductase, gamma subunit
Orthology
K00189  
2-oxoisovalerate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.7]
Organism
tac  Thermoplasma acidophilum
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ta0626m
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Ta0626m
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
657996..658559
Genome map
AA seq 187 aa AA seqDB search
MYEIRFHGRGGQGAVTASRILAAAAFAEGKYVVSFPFFGTERRGAPVTAFTRIDDSEIYL
KSQIYNPDIVVVLDTYVLRTSNVMEGLKENGTVIINSPRDPADFNLDANVATVDAVAIAV
KHGLGSRANPVINTSMLGAFSRVTGIVSLESVLEATRQNVPAKVKENMDAVKEAYDSVKI
LKREEIR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagattaggttccacggaagaggtggtcagggcgctgtgactgccagcaggata
ctggctgcagccgcctttgccgagggcaagtacgttgtgtccttcccattcttcggtacg
gagaggagaggcgcacctgttaccgccttcacgaggatagatgattcagagatctatctg
aagagccagatttacaaccctgacatcgttgttgtcctggacacatacgttctgagaacc
tcgaacgtcatggaggggctgaaggaaaacggaactgtcataataaactcacccagagat
cctgccgattttaacctggacgccaatgttgcaaccgtggatgcagttgcgatagccgtc
aagcatgggcttggaagcagggcgaatccggtcataaatacttcaatgctgggtgcgttc
tcaagggtcaccggaatagtatcccttgagagtgtgctggaagccacgaggcagaacgtg
ccggcaaaggtgaaggagaacatggatgctgtgaaggaagcctacgattcagttaagatt
ctgaagagggaggagataaggtga

DBGET integrated database retrieval system