KEGG   Thermoplasma acidophilum: Ta0627Help
Entry
Ta0627            CDS       T00037                                 

Definition
pyruvate ferredoxin oxidoreductase, delta subunit
Orthology
K00188  
2-oxoisovalerate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.7]
Organism
tac  Thermoplasma acidophilum
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ta0627
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     Ta0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658565..658855
Genome map
AA seq 96 aa AA seqDB search
MVLVPVSTVSTRNHLTDSWRIQRPTIQYDKCIRCMICWKYCPDNAINIENGNKEAPNERI
AKMEYPVIDYNFCKGCGICANECPEKCIDMEFEVIE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttgtacccgtgtcaacggtttcaacgaggaatcatctaacggacagctggcgc
atacagaggccaaccatacagtacgataaatgcataagatgcatgatctgctggaagtac
tgccctgataacgccataaatatagaaaatgggaataaagaggctccaaacgaaaggatt
gcaaagatggagtatcctgtgatagactacaatttctgcaagggttgtggcatatgcgcc
aatgaatgccctgaaaaatgcatagatatggaattcgaggtgatagaatga

DBGET integrated database retrieval system