KEGG   Thermoplasma acidophilum: Ta0669Help
Entry
Ta0669            CDS       T00037                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ta0669
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ta0669
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ta0669
Enzymes [BR:tac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ta0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
702797..704071
Genome map
AA seq 424 aa AA seqDB search
MIRIDLKQDEMPDHWYNILPDLPEELPTPRDETGEAFDTLKKAVPAKVLEYEFSGERYPK
IPDEILERYMQVGRPTPIIRAKKLEELLGGNLKIFLKMESYTYSGSHKINSALAHVFFAR
EEGAKFVSTETGAGQWGSAVALASALFHMESHIFMVRTSFYAKPYRKYMMYMYGAHPHPS
PSEFTEYGREVLKRMPDTPGSLGLAISEAIHYALDNGGKYIAGSVINSDILFKTIAGMEA
KKQMEMAGEDPDYIVGVVGGGSNYAALAFPFLADELSSGKIRRTYIASGSKEVPKMTEGE
YRYDYPDTGKVLPLLKMYTIGYDFIPPAVYAGGLRYHAVAPTLSLLMNKGIVSARDYDQE
EAFKWARIFSETEGYIPAPETSHALPILKEIADKNRGEKKTVLVSFSGHGLLDLGNYAEA
LHFE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgataagaatagatctaaaacaggacgagatgccagatcactggtacaacattttgccc
gatctcccggaggaactgccaacacccagggacgagactggagaggcattcgatacgctt
aagaaggctgtgccggcaaaggttctggagtacgagttttccggcgagcgctatccgaag
atacctgatgagatactcgagaggtacatgcaggttggcaggccgaccccgataataagg
gcaaagaagctggaggaattgcttggaggaaatctgaagatattcctgaagatggaatcc
tacacgtattcaggttcgcacaagataaacagtgcgcttgcgcatgtcttctttgcgagg
gaggagggcgcaaaattcgtatcaacggaaacgggtgcaggccagtggggttccgcagtt
gccctcgcctcggcgctcttccacatggaatcgcacattttcatggtacggactagtttc
tatgcaaagccataccgcaaatacatgatgtacatgtacggggcacacccccatccaagt
ccatccgaattcacagagtatggaagggaagtcctgaagaggatgccggacactccagga
tcgcttggtctagccataagcgaggccatacattacgcacttgacaatggtggaaagtac
atcgctggaagtgttataaattcggacatacttttcaaaacaatagcaggcatggaggca
aagaagcagatggagatggccggtgaggatccggattacatagtcggtgtcgttggcggt
ggttcgaactacgccgcacttgccttcccgttcctggccgacgaactttcctcaggaaag
atcaggaggacgtacatagcctctggatcgaaggaggtgcccaagatgacggagggcgaa
tacaggtatgattatcctgacaccgggaaggttctgcccttgctcaagatgtacaccatc
ggttacgacttcatacctccggcagtttacgccggcggcctgcgctatcacgcagttgcc
ccaacgctaagcctgctgatgaacaagggcatagtgtctgcaagggattacgatcaggag
gaggcattcaaatgggcaaggatattctcagaaacggagggttacatacctgctccagaa
acatcgcatgcacttcccatactgaaggaaatagcagataagaacagaggcgagaagaag
accgttcttgtaagcttctccggccatggcctcctcgatcttggcaactatgcagaagcc
ctgcatttcgaatga

DBGET integrated database retrieval system