KEGG   Thermoplasma acidophilum: Ta0769Help
Entry
Ta0769            CDS       T00037                                 

Definition
(GenBank) probable acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00010  Glycolysis / Gluconeogenesis
tac00620  Pyruvate metabolism
tac00640  Propanoate metabolism
tac00680  Methane metabolism
tac00720  Carbon fixation pathways in prokaryotes
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
tac01120  Microbial metabolism in diverse environments
tac01130  Biosynthesis of antibiotics
tac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta0769
   00620 Pyruvate metabolism
    Ta0769
   00640 Propanoate metabolism
    Ta0769
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ta0769
   00680 Methane metabolism
    Ta0769
Enzymes [BR:tac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ta0769
Lipid biosynthesis proteins [BR:tac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ta0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAC11901
UniProt: Q9HK38
Position
809631..811430
Genome map
AA seq 599 aa AA seqDB search
MASELDGFKKWDKDLEGDLGKFEFFVNGYSNVSFNCIDRHAMKTPQKTAIIWLSEDGLRQ
SITYRDLMLQTAKFAKGLADEGVKMGDVVTIFLPNRIEAFIAAHACFRIGAIYNIIFSGF
SAKALLDRMKETNPKVVITTDSSLRRGRKINLKETLDSIISEVPSVKKVIIIKRDGKHDL
NLGEREVYYDDFMSGITGYAEPVPIEANAPGFVIYTSGTTAKPKGVVHSGIGFLVGSYHN
VKYALDLGPEDIFWCTADVGWLTFPIFELVGGLAHGATVIAYEGALDYPDIRHFYSIIQD
FKVTKLFTAPTFLRMLARNGSDVASGYDLSSLRLISLVGEPLDVKTWKWVYNDLGHGRIE
INNTYGQTETGSAWTSSLVGVTGARPGSCGLPLPGHSFDILDEGGQPVENGRIGTLVLRK
PFPSLARGIWKDPQRYFKEYLSVFPGNYCTYDSAVRDRYGHIWVLGRTDDVINVSGHRIS
TMEMEDAIMSIPEVSEAAVVGVDHAIKGMSTAVFVTLGNGIDLPADLGKRIQDEIARRIG
NYAKPESVYVIPEMPKTRSGKIMRRLLREIVISNKVSGDLTGLEDPGVISRILQEMKQA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtggcatctgaattggacgggttcaagaaatgggataaagatcttgaaggtgatcttgga
aaattcgaatttttcgtcaatggatacagcaatgtcagttttaactgtattgacaggcat
gcaatgaaaacacctcagaagactgctataatatggctgagtgaggacggtttacggcaa
tcgataacctacagagatctcatgctgcagaccgcgaaatttgcgaaaggattggcagat
gaaggcgtaaaaatgggagatgtcgtgacgatctttctccccaatagaatagaggcattc
atagctgcccatgcctgcttcagaattggggcgatatataacataatattttctgggttt
tctgctaaagcccttctggataggatgaaggaaactaacccaaaggtggtaataaccaca
gacagcagtctacgccggggaagaaaaatcaacctgaaggagaccctagactcaataatc
agtgaagtgccgtccgtgaagaaagtcatcataatcaagagagacggcaagcacgatctg
aatctgggtgaaagggaagtatactacgatgactttatgtcaggaataacgggatatgcc
gaaccggtgcctatcgaggctaatgcacctggttttgtcatatacacttctgggacaacg
gccaagcccaagggcgtggtccattccggcataggttttcttgttggatcctatcacaat
gtaaaatatgcgcttgatcttgggcctgaagatatcttctggtgtaccgccgacgtggga
tggctgacgttcccgatcttcgaactcgtgggcggcctggcacacggtgcaacggtcatt
gcatacgagggggcgctggattaccctgacataaggcatttctacagcattatacaggat
ttcaaggttacgaaattgttcacggcgccaacctttttgagaatgcttgccaggaatgga
tcggacgtggcttctggatatgacctgagcagcctgaggctgatatcgctggttggggaa
ccgctagacgtgaagacatggaaatgggtgtacaacgacctcgggcacgggaggatagag
ataaacaacacctacggccagacggaaacagggagcgcatggacttcctctcttgtgggc
gttaccggtgcaaggcccggttcatgcgggcttccactcccaggtcactcatttgatata
cttgacgaaggtggtcaaccagttgaaaatggaaggatagggacgctcgtattgagaaag
ccattcccttcacttgcaagaggaatatggaaagacccacagagatatttcaaggaatat
ctttctgttttcccggggaattattgtacctatgattctgccgtccgtgacaggtatggc
catatatgggtactcggaagaactgacgatgtgataaatgtttccgggcacaggatctcc
acaatggagatggaagatgcaataatgtctataccggaggtttctgaggctgccgttgtt
ggtgtcgatcatgctataaaaggcatgtcaactgcggtatttgtcaccctcggcaacgga
attgatttgccagcagatctaggaaaaaggatacaggacgaaattgctagaaggataggt
aattatgccaagcctgaaagtgtatacgtgatcccagagatgccaaagacgcgtagcgga
aagataatgcgaagactgttgcgagagatcgtaatcagcaataaagtgagcggtgatctg
acaggcctcgaggatcccggtgtgatttcgcgcatactgcaggagatgaagcaggcttaa

DBGET integrated database retrieval system