KEGG   Thermoplasma acidophilum: Ta0808Help
Entry
Ta0808            CDS       T00037                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase related protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tac01100  Metabolic pathways
tac01110  Biosynthesis of secondary metabolites
tac01130  Biosynthesis of antibiotics
tac01230  Biosynthesis of amino acids
Module
tac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ta0808
Enzymes [BR:tac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ta0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAC11937
UniProt: Q9HK02
Position
860429..861142
Genome map
AA seq 237 aa AA seqDB search
MNIEDIFANNRTRSCEYRRERRTVSLRRAIELCNGEGRRGLIAEYKRRSPSGFSTDEDIS
SYLSYVKMHRIAGLSILSEPTHFSGSFDDVTLAHRIGVPVLVKDFAPDDHFVESAYNAGG
DAVLAILDFLPSEDVERIVRRSADLGMDVIEEYHDRKALKKFVDGDNVILGYNRRDLVSL
KTGEDQDMPQYDITILESGINIDNVVHVDMRYSGFLIGTSILKRDGTLEYLEKNRII
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaagacatattcgccaacaacagaacgaggagttgcgagtacaggcgcgaa
cgcaggaccgtgagcctcaggagggccatagaactgtgcaacggtgagggaagaaggggc
ctcatagcggagtacaagcgcaggtcgccgtccggcttcagtaccgatgaggatatctca
tcgtacctgtcctacgtgaagatgcaccgcatagccgggctgagcatactcagcgaaccc
actcacttctccggatcattcgatgacgtgaccctggcgcacaggatcggcgtgccagtc
ctggtaaaggacttcgctcctgatgatcacttcgttgaatctgcctacaatgccggagga
gatgccgtgctggccatactggacttcctgccgtcggaggatgttgagagaatagtgcgc
agatccgcagatctaggcatggacgtgatcgaggagtaccatgacagaaaggccctgaaa
aaattcgtggatggagacaacgtcatcctggggtacaacaggcgcgatctcgttagcctt
aagaccggcgaggatcaggatatgccgcaatacgacatcacaatactggaaagtgggata
aacatagataatgtcgttcatgtggatatgcgatacagcgggttcctcataggaacgtcc
atattgaaaagagacggcacgcttgagtacctcgagaaaaaccgcataatatga

DBGET integrated database retrieval system