KEGG   Thermoplasma acidophilum: Ta0810Help
Entry
Ta0810            CDS       T00037                                 

Definition
(GenBank) probable aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tac  Thermoplasma acidophilum
Pathway
tac00030  Pentose phosphate pathway
tac01100  Metabolic pathways
tac01120  Microbial metabolism in diverse environments
tac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ta0810
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Ta0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: CAC11939
UniProt: Q9HK00
Position
complement(862786..864597)
Genome map
AA seq 603 aa AA seqDB search
MVGGFTGKILRVDLGKGEIKVEDTNMQWARDYIGGQGLATRYYVEEVDPKIDPYDPDNEL
IIAPGPLTGTSAPTAARYMAVTKSPLTGTITRSNSGGYFGAKLKHTGFDMIIFKGRSEKP
VYLYVDKGKAEIRDASDLWGKDVFETTDTLTKRIGGNVSVACIGPAGENLVKFASIMNDK
HRAAGRNGVGAVMGSKKLKAIVAGGGRMPAIGDPEMYKAVLPKMLKKIKENPVTSQGLTQ
FGTEVLVNIINRSGIYSNRNLTDSGDDPLADDVSGETLAETYLIHNQPCFACPIGCGRVV
RYNERESEGPEYESTWALGPNTGVHDLYTIIAANDNADRLGYDTISAGLTISAAMELYEK
GKIPDKDVGPTKPKFGNTSALLEMTAKIGYRKDFGDKLAEGSYRLAKMYGDESVSMSVKG
QEIAAYDPRGVWGLALEYATSNIGGSHMRAYTISNEILGVEPTQDPLQLEGKADLVKYVQ
DFTEVMDCSGLCQFPSFALNLDDYIELVNAVTGFKYTKEEIMKAAERVWNLERLFNLKAG
IKPEDDKLPERFLKVPLPKGPKKGNVVPMQKLLQDYYGARGWDSRGYPTEEKIKELGLEF
YKL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtggcttcacgggcaagatcctcagggttgacctggggaagggcgagataaag
gttgaggatacgaacatgcagtgggcgcgcgattatatcggcggccagggactggcaacg
aggtattacgttgaagaggtggatccgaagatcgatccgtacgatccagacaacgaactc
ataatagctccgggcccgctcaccggaacgagtgcaccgacagctgcaaggtacatggct
gtgacgaagagcccgctcacgggcacgatcacaaggagcaactccggcggttatttcggt
gcaaagctgaagcacaccggttttgatatgataatattcaaagggagatcagagaagccg
gtatatctatatgtggacaagggaaaggccgagatccgcgatgcatccgatctctggggc
aaagacgtcttcgagaccacggacactctcacgaaaaggataggcggaaacgtcagcgtt
gcctgcataggccctgccggcgagaacctggtcaagtttgcatccataatgaacgacaag
cacagggcagctggtaggaacggcgtcggagcggtaatggggtccaagaagctcaaggct
atagtggcgggcgggggcaggatgccagccatcggagacccggagatgtacaaggccgtg
cttccaaaaatgttgaagaagataaaggagaaccccgtgacatcgcaggggctcacgcag
ttcggcactgaggttctggtgaacataataaacagaagcggcatatattcgaacaggaac
ctgacggattccggcgatgacccgcttgctgatgatgtcagcggcgagacgctggcagaa
acgtacctgatccacaaccagccatgctttgcttgcccaatcggctgcggccgtgtagta
aggtacaacgaacgcgagagcgaggggcccgagtacgagagcacatgggccctcgggccg
aacaccggcgttcacgacctctacaccatcatagctgcgaacgacaacgcagaccgcctg
ggctacgacaccatatcggccggcctgacgatatcggctgcgatggagctctacgagaag
ggaaagataccggacaaggacgtcggcccaacaaagcccaaattcggaaacacatcggcg
ctgctcgagatgacggcaaagatcggctacaggaaggacttcggcgacaagcttgcggag
ggttcataccgcctcgcgaagatgtatggggacgagagcgtatccatgagcgtgaagggg
caggagatagcggcatacgatcctaggggtgtctggggcctggctctggagtatgccaca
agcaacataggcggatcgcacatgagagcctacaccatatcgaacgagatactgggcgta
gagccgactcaggatccgctgcagcttgagggaaaggcggatctcgtgaaatatgtgcag
gacttcaccgaggtcatggactgctccggcctgtgccagttcccttcatttgccctgaac
ctggatgattacatcgaactggtaaatgccgtaacaggcttcaaatacacgaaggaggag
ataatgaaggcagctgaacgcgtctggaaccttgagaggcttttcaacctgaaagctgga
ataaagcctgaggacgataagctgccggagaggttcctcaaggtaccgctgccgaagggc
ccaaagaaggggaacgtcgttccgatgcagaagctgctgcaggattactacggggcacgc
ggatgggacagcaggggctatccgaccgaagaaaagataaaggaactgggactggaattc
tacaaactgtga

DBGET integrated database retrieval system