KEGG   Thermoplasma acidophilum: Ta0825Help
Entry
Ta0825            CDS       T00037                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta0825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta0825
   00052 Galactose metabolism
    Ta0825
   00500 Starch and sucrose metabolism
    Ta0825
   00520 Amino sugar and nucleotide sugar metabolism
    Ta0825
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ta0825
   00524 Butirosin and neomycin biosynthesis
    Ta0825
Enzymes [BR:tac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ta0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883084..884058
Genome map
AA seq 324 aa AA seqDB search
MSLNILGYDVGGTKISTVVGNDSGEILSNVRMPTVKHLGKKRLIEEMITMGDAALKKAHV
EKPDLIGIIFAGPVDRNRGVVIASPNIFGLSNFNIVEPIRDYYRTDTFLENDAQAAAIAE
RLFGSGRNVDNFVYMTLSTGIGGGIFINGKLYRGAHGMAGEIGHNVIMVNGPTCGCGRRG
CLEALAGGKAIARRVIENLRAVRDSDFFSKLRPNEITAEKVFEGKKQGDMFSQLILEETI
YYLAVGLVNIINTLDPELVIIGGGISKAGKDLFDPLNDAVKEEFKSMYRPFKIVPGLENG
SDLAAISVPLYTEMELHGEGEKQY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgtcattgaatattctcggatatgatgttggcggtacaaagatatcaacagttgtaggc
aacgattccggtgaaatactctccaatgtacgaatgcccactgtcaagcatctcgggaag
aagaggcttatagaggagatgatcaccatgggcgatgccgccttaaagaaagcccatgtg
gaaaagccggatctgatcggcataatatttgccggccctgttgaccgcaacagaggcgtc
gtgatagcttcgccaaatatcttcgggctgagcaacttcaacattgtggagccgataagg
gattattatagaacagacacgtttctggaaaacgatgcgcaggcagctgccatagctgag
aggctcttcgggtcgggaaggaacgtcgataatttcgtttacatgacgctgagtactgga
ataggcggtggaatattcataaacggaaaactttaccgcggggcccatggaatggcggga
gagataggccacaatgtcataatggtcaatgggccgacatgcggatgcggaaggcgcggc
tgccttgaagctctggccggaggcaaggccattgcgagaagggtgatcgaaaacctgcgg
gcagtacgggattctgacttcttttcgaagctgaggccgaacgagatcacggcagaaaag
gtcttcgaaggcaagaagcagggcgatatgttctcgcagctgatacttgaagagacgata
tattacctggctgttggccttgtgaacataataaatacgctggatccggagctcgtgata
ataggtggtggaatctcgaaggcgggcaaggatctctttgatccgctcaacgacgcggta
aaggaagaattcaagagcatgtacaggccattcaagatcgttccaggactggaaaatgga
tcggatctcgcggccatatcggtaccgctgtacacggagatggagctgcatggcgaagga
gaaaagcagtattga

DBGET integrated database retrieval system