KEGG   Thermoplasma acidophilum: Ta0832mHelp
Entry
Ta0832m           CDS       T00037                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ta0832m
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta0832m
  Lipid metabolism
   00071 Fatty acid degradation
    Ta0832m
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ta0832m
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ta0832m
   00626 Naphthalene degradation
    Ta0832m
Enzymes [BR:tac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ta0832m
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(893955..894626,894626..895072)
Genome map
AA seq 372 aa AA seqDB search
MREIMSIITLPRKIYQQRDIIDNIRETLQLKEPILLVSDRNIMKLYGQRIKNALDGSDYR
VIEDVRPEPEVSDIENTYRSLSGFQPKTIIAFGGGSVIDFAKSIDVKISYPDRSLEEVNP
FEPLNLKADLVAIPTTSGTGSDVSFGIVITDQGRKLALGNFDLVPYVSVLDSSLVPSDPS
IIRPTGVDALVHSFEALTANTSSIFTDALAEKAIETIFGILIDPMKGEEDARENMHLAAT
MAGISFTNSGTALAHALGHSFGSTHHVVHGTCVGLFLPYVIEFNSSDENASEKYARIARR
LGYKDAISALRDLYRRIGQPLTVAEIGIPKDAYMKSLDSMVEKALADSELAFNPVIAGDE
DVRSIYIKAYGD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgaaatcatgagcatcataaccttgccaaggaagatctatcagcagagggacata
atagataacataagggaaaccctgcagctaaaggagcccatattgctggtcagtgacaga
aacatcatgaaattgtacggccagagaatcaaaaatgcgctcgatggatcggattaccgc
gtaatagaagatgtgaggccagaaccggaagtctctgacatagaaaatacgtatagaagc
ttgtccggctttcagccaaagaccatcatagcctttggaggcggcagcgtgatcgacttt
gccaagtccatcgacgtgaagatatcctatccggacagatccctggaggaggttaatccc
ttcgaacctctaaaccttaaagctgatcttgttgccataccgacaacttccggtactggc
agcgacgtatcattcggcatcgtcattaccgatcagggaagaaagcttgcactcggcaat
tttgatctggtaccatacgtttctgtattagactcatcgcttgtgccgtccgatccatcc
atcatcaggccaaccggcgttgatgcgcttgtccactcctttgaagccctaactgcaaat
acatcatccatattcaccgatgcactggcggagaaggcaattgagaccatatttggaatc
ttgatcgatccaatgaagggcgaagaggatgcaagagagaacatgcatctggccgcgacc
atggccggcatctcattcacaaacagcggcactgcactcgcacatgctctgggccacagc
ttcggctcaacgcaccatgttgtacatggcacctgcgttggtttattccttccctacgtg
atagaattcaactcttccgatgaaaatgccagtgaaaagtatgcaaggatagccagaagg
ctaggttataaagatgctatatctgccctcagggatctgtacaggaggatagggcagcct
ctcaccgtagcagaaatcggcataccaaaggatgcatacatgaagagcctggacagcatg
gttgaaaaggcgctggcggatagcgagcttgccttcaacccagtgatcgccggcgacgag
gacgtaagatccatatatatcaaggcctacggtgattga

DBGET integrated database retrieval system