KEGG   Thermoplasma acidophilum: Ta0834Help
Entry
Ta0834            CDS       T00037                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tac  Thermoplasma acidophilum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Class
Metabolism; Overview; Carbon metabolism [PATH:tac01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tac00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
895065..896840
Genome map
AA seq 591 aa AA seqDB search
MIDLGGFWNKLIFVDLSGRDVWFDGLSEDLWEKYMGGVGLGSYLFTKYGGNFDPFSEKNP
IIIMTGPLVGTAFPNSGRHEVVSRSPLTTFLGESNSGGRFGFELKRSGSDGMVITGKSDV
PVSIFIDDGDVRLAETPDLWGLDIYETQAKMKKEKNYSVMCIGPAGENRVLFSSIMNDEG
RAAGRTGLGAVMGSKKLKAIAVYGRKIVEVNNRAEYNRIVKEASKSIIESPVVSGFRSYG
SMIWMDGGIGFNDIPANYFMDRNFQFDDLSSIKFHEEYSVSSYNCAACVIGCGRTVRYNG
LTVDGPEYETVAALGPLLGNTSFQKIIEWNHEINRLGMDTISTGVIVSAIRHFIKAGLVN
DGSVESYYSGSFEKIGQMIQDIAMRRGSGDRIADGLYRFASSLGIDRDLIATVKGLEIPL
HDPRAFKAQGIVYATSTRGADHMQGDMYQIDIGGDHPDLGIVSGDRFSVDSDDRVRTVIR
TQDFRQVYNSLIICYYAQPDPETIAKAYALATGFDSSIKDLVDRGSEIINLKRRINEGLG
MRPEDDWLPAIVRMPIEGESPESGTSDEELISAIQRYYRLRGWGRYRPPVR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatttgggcggattctggaacaagcttatcttcgtggatctgtcagggcgcgat
gtatggttcgatggcctctccgaagatctatgggaaaagtacatgggtggagtgggcctt
ggatcctatctcttcaccaaatacggtggaaacttcgatccgttctccgagaagaacccg
atcataatcatgaccggcccgctggtcggaaccgcgttccccaattccggaaggcatgag
gttgtgagcaggagcccgctcacaacgtttttaggggaatcgaactctggcggcaggttc
ggattcgaactgaagcgatccggttctgacgggatggtcataacgggaaagtcagatgtg
ccggtatcgatcttcatcgatgacggcgatgttcgcctggcagaaacaccggatctctgg
ggccttgacatatatgaaacgcaggctaagatgaagaaggaaaagaattactcggttatg
tgcataggccctgccggcgagaaccgcgtcctcttttcatcaataatgaatgatgagggg
cgcgcagccgggaggaccggactcggcgctgtcatgggatcgaagaagctgaaggccatc
gccgtttatgggcggaagatcgtcgaggtaaacaatagggccgagtacaacaggatagtg
aaggaggcctcaaaatctataatcgaatcacccgttgtctctgggttcagaagctacgga
agcatgatatggatggacggcgggataggtttcaacgatatcccggccaactacttcatg
gataggaacttccagttcgacgatctcagcagcataaagttccacgaggaatacagcgta
tccagctacaactgtgctgcctgcgtcataggctgcggaaggactgttagatacaacggc
ctcacagttgacgggccggaatatgaaacggttgcagctttggggccgctcctggggaac
accagtttccagaaaataatagaatggaaccatgaaatcaacaggcttggcatggacacc
ataagcaccggcgtcatcgtctctgcgatcaggcatttcatcaaagccggtttggtaaac
gatggatcagtcgaatcgtattactccggaagcttcgagaaaataggccagatgatccaa
gacatagcgatgaggagaggttccggagatcgcattgccgatggcctctatcgcttcgcc
tcctcccttggaatagacagggatctcatagctacggtcaaaggcctggaaataccgctc
catgatcccagggccttcaaggcacagggcatcgtgtatgcaacctcgacaaggggtgca
gaccacatgcagggggatatgtaccagatcgacatagggggcgatcatccagatctgggc
atcgtttccggcgacagattcagcgtggacagcgatgaccgcgtccggacggtaataagg
acgcaggacttcaggcaggtttacaactcgctgatcatatgctattacgcgcagcctgat
ccggaaacaatagccaaagcgtacgctctcgcaacgggattcgattcatcgatcaaagat
ctggttgaccgcggatctgaaataataaaccttaagaggaggatcaacgaaggccttggc
atgaggccggaggacgactggcttccagcgatagtcagaatgcctatagagggcgaatcg
cctgaatccggtacctctgacgaggagctcatatcggcgatccagaggtattacaggctg
agggggtggggaaggtacaggcctcctgtgcggtga

DBGET integrated database retrieval system