KEGG   Thermoplasma acidophilum: Ta0880Help
Entry
Ta0880            CDS       T00037                                 

Definition
(GenBank) ribokinase related protein
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
tac  Thermoplasma acidophilum
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ta0880
   00240 Pyrimidine metabolism
    Ta0880
Enzymes [BR:tac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Ta0880
    2.7.1.213  cytidine kinase
     Ta0880
    2.7.1.-  
     Ta0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
947914..948777
Genome map
AA seq 287 aa AA seqDB search
MRFLAYFGHLNIDVLISVDSIPREGSVNVKDLRPRFGGTAGNFAIVAQKFRIPFDLYSAV
GMKTHREYLAMIESMGINTGHVEKFEDESGPICYIATDGKKQVSFMHQGAMEKWKPQLAD
EYEYVHFSTGPNYLDMAKSIRSKIIFDPSQEIHKYSKDELKKFHEISYMSIFNDHEYRVF
REMTGLSSPKVTTIVTNGERGSSLFMDGKKYDFPAIPSSGDTVGAGDSFRAGLYLALYNR
RSIEKGMIYGTIIAHHVIDDGIENFSLNMEDLERETENYRRMFTKRS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttctcgcctactttggacatctcaacatagacgttctcatatcggtagattca
attccgcgtgaaggatctgttaatgttaaggatctcaggccacgcttcggcggtaccgct
ggaaactttgccattgttgcacagaagttccggattccattcgacttgtactcggctgtg
ggaatgaagacgcacagggaatacctggccatgatcgagagcatgggcataaatacgggc
cacgtggagaagttcgaagatgagagcggcccgatatgctatattgccactgacggaaag
aagcaggtctcctttatgcatcaaggggcaatggaaaaatggaaaccgcagttagcggat
gaatacgagtatgttcatttcagcaccggacccaattatctggatatggccaagagcatc
agatcgaaaataatattcgatccttcgcaggagatacacaaatattccaaagacgaacta
aagaaattccatgaaatttcgtacatgtccatattcaacgatcacgagtaccgcgtattc
agagaaatgactggcctgagctctccaaaggttacgacgatcgtaaccaatggagaaaga
ggatcttcactgttcatggatgggaaaaaatatgattttcctgccatcccatccagtggt
gatacggttggtgccggggactccttccgagcaggcctttatctggccctctacaaccgc
aggagcatagaaaagggcatgatctacggcacaataatagcacaccacgttatagatgat
ggaatcgaaaacttttcgctcaatatggaagatctggaaagagaaaccgagaattacaga
cgcatgttcacaaagagatcctga

DBGET integrated database retrieval system