KEGG   Thermoplasma acidophilum: Ta0880Help
Entry
Ta0880            CDS       T00037                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tac  Thermoplasma acidophilum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ta0880
Enzymes [BR:tac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ta0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
947914..948777
Genome map
AA seq 287 aa AA seqDB search
MRFLAYFGHLNIDVLISVDSIPREGSVNVKDLRPRFGGTAGNFAIVAQKFRIPFDLYSAV
GMKTHREYLAMIESMGINTGHVEKFEDESGPICYIATDGKKQVSFMHQGAMEKWKPQLAD
EYEYVHFSTGPNYLDMAKSIRSKIIFDPSQEIHKYSKDELKKFHEISYMSIFNDHEYRVF
REMTGLSSPKVTTIVTNGERGSSLFMDGKKYDFPAIPSSGDTVGAGDSFRAGLYLALYNR
RSIEKGMIYGTIIAHHVIDDGIENFSLNMEDLERETENYRRMFTKRS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttctcgcctactttggacatctcaacatagacgttctcatatcggtagattca
attccgcgtgaaggatctgttaatgttaaggatctcaggccacgcttcggcggtaccgct
ggaaactttgccattgttgcacagaagttccggattccattcgacttgtactcggctgtg
ggaatgaagacgcacagggaatacctggccatgatcgagagcatgggcataaatacgggc
cacgtggagaagttcgaagatgagagcggcccgatatgctatattgccactgacggaaag
aagcaggtctcctttatgcatcaaggggcaatggaaaaatggaaaccgcagttagcggat
gaatacgagtatgttcatttcagcaccggacccaattatctggatatggccaagagcatc
agatcgaaaataatattcgatccttcgcaggagatacacaaatattccaaagacgaacta
aagaaattccatgaaatttcgtacatgtccatattcaacgatcacgagtaccgcgtattc
agagaaatgactggcctgagctctccaaaggttacgacgatcgtaaccaatggagaaaga
ggatcttcactgttcatggatgggaaaaaatatgattttcctgccatcccatccagtggt
gatacggttggtgccggggactccttccgagcaggcctttatctggccctctacaaccgc
aggagcatagaaaagggcatgatctacggcacaataatagcacaccacgttatagatgat
ggaatcgaaaacttttcgctcaatatggaagatctggaaagagaaaccgagaattacaga
cgcatgttcacaaagagatcctga

DBGET integrated database retrieval system