KEGG   Thermoplasma acidophilum: Ta0934mHelp
Entry
Ta0934m           CDS       T00037                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tac  Thermoplasma acidophilum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tac01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tac00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1002584..1003768)
Genome map
AA seq 394 aa AA seqDB search
MPDRDFIVEVARRIIRIPAISPASGGEGEKDRADEIEKILRELGYNDYQRYDMKDEYGKI
RSNIVIRAGKGEKVLWLVAHIDTVPVGDPALWTKPPFDVTVEGDRMYGRGTEDDGQAVFT
ALLILRDIKKNGLKQKMQFGVAFVADEEMGSKYGIQYLLEKDIFRKSDLIIVPDAGSEDG
MTIEIAEKSILWIRFSVKGKQWHASMPVNAINAFREGSKFMIDLDRRLHEKFTVKDDLYN
VPYSTFEPTKHEKNVDNVNTIPGTDTFYFDCRVLPQYSLDDVLKTVDEAISDFQAHSQAR
ISYDLVQKEQAPKKTPEDSEVVVRLMESIKKKRGKTPKAIGIGGGTCAAFFRRLDIPAVV
WFTTIEENAHRPDEFCLISHILMDRDVLEDVLVS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatagggatttcatagttgaggtagcaaggaggatcataagaatacccgccata
tcgccggcctcaggtggagaaggtgaaaaggatagggcagatgagatcgagaagatactc
agggagcttggctataacgattatcagagatacgatatgaaggatgagtatggaaagatc
aggtctaacattgtgatcagggcaggaaagggtgaaaaggttctctggctcgttgcgcat
atagataccgttccggtcggagatcctgcactttggacaaagccaccgttcgatgtgacg
gtagagggagaccgcatgtatggcagaggaaccgaggacgacggtcaggcggtgttcact
gctctattaatcctaagggatatcaagaaaaatggcctcaaacagaagatgcagttcggt
gtagcattcgtagcggacgaggagatgggaagcaaatacggaatccagtatctgcttgag
aaggacatattcagaaaatccgatctcataattgttccggacgcaggaagcgaggatgga
atgaccatagagattgcggagaagagcatactctggatccgcttcagcgtgaagggaaag
cagtggcacgccagcatgcctgtcaatgcgataaacgccttcagagaaggttccaaattc
atgatcgatcttgaccgcaggctgcacgagaagttcaccgtaaaggacgatctttacaac
gttccttactcaacgtttgaaccgacgaagcacgaaaaaaacgtggataacgtgaacacg
ataccagggacagacaccttctacttcgattgcagggttctgccgcagtacagcctggac
gatgttctgaagacagttgatgaagccatatccgacttccaggcccacagccaggccagg
atatcgtacgatctggtgcagaaggagcaggcaccgaagaagactcctgaggattctgag
gttgtcgttaggctgatggaatcaataaagaagaagaggggaaagacaccaaaggcaatc
ggaataggaggcggtacatgcgcagctttcttcagaaggcttgacataccagcggtggtg
tggttcaccaccatagaggaaaatgcacacaggccagatgaattctgcctcatatcacac
atactcatggacagggacgttctagaggacgttcttgtctcataa

DBGET integrated database retrieval system