KEGG   Thermoplasma acidophilum: Ta1004Help
Entry
Ta1004            CDS       T00037                                 

Definition
succinate dehydrogenase, subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tac  Thermoplasma acidophilum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta1004
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ta1004
   00650 Butanoate metabolism
    Ta1004
  Energy metabolism
   00190 Oxidative phosphorylation
    Ta1004
   00720 Carbon fixation pathways in prokaryotes
    Ta1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1075695..1076066
Genome map
AA seq 123 aa AA seqDB search
MAETEKMKYGSLNRFAQAVTGLFLLFFLGVHLYVAHIDFGHPVAFFSSVINQLHNPWWLA
FFLIFVYIITYHGINGLNHIVADTSISEKAKRNIGIALMVIYVITIIYGTILALLVARMT
VPT
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacggaaaagatgaagtatggatctttgaacagatttgctcaggccgtgacc
ggtctatttctgctattcttccttggagtgcacctgtatgtcgcgcacatagactttggc
catccagtggcattcttcagttccgtaattaatcaactgcataatccatggtggctggcg
ttcttcctgatcttcgtttacatcatcacttaccatggaataaatgggttgaaccacata
gttgcggacacaagtataagcgagaaggcaaagagaaacataggcatagctctgatggtc
atatacgttataaccataatatacgggacgatactggctctgctggttgcaaggatgacc
gttcccacataa

DBGET integrated database retrieval system