KEGG   Thermoplasma acidophilum: Ta1058Help
Entry
Ta1058            CDS       T00037                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tac  Thermoplasma acidophilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ta1058
Enzymes [BR:tac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ta1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130212..1131123)
Genome map
AA seq 303 aa AA seqDB search
MGDHGDAKDHASELKDIFSLKKIADAKYSYEDSDYVIFGVPFDNTSSYRRGSKYAPDSIR
SAYVNLESFEFSYRFDLLRARISDLGDMEESEDVEYVVDQVDRVTKMVFSDGKIPIMLGG
EHSITVGAVRNFPEDVHMVIVDAHSDFRDSYMGNKLNHACVTKRALEILGPNRITSIGTR
SVSLEEYQDPDFEKVEFIPSFSVREYGIERFINDIERRPGRVYISIDMDGIDPAYAPAVG
TPEPFGLTDYEVRRLVERLSYKAIGMDINEFSPLYDNGNTSMLAGKLIQVFIASREKYRI
EHI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgggagaccatggggatgcgaaagatcatgcttcagaactgaaggatattttttcgctg
aagaagatcgcggacgccaagtacagctatgaagacagcgactatgtgatatttggcgtc
ccatttgacaacacatcaagctacaggcggggctcgaaatacgcccccgattccataaga
tcggcatacgtgaatctggaatcgtttgaattctcctaccggtttgacctgctcagggcc
agaatatcggatcttggtgacatggaagaatccgaggacgtggagtacgttgtcgaccag
gtcgatcgtgtaacgaagatggtattcagcgatggaaagatacctataatgctgggcggt
gaacactccataaccgttggtgccgtcagaaactttcctgaagacgtgcacatggtaata
gtggatgcgcattccgatttcagggattcgtacatgggaaacaaactgaaccatgcctgc
gttacgaaacgcgcgctggagatactgggcccaaacaggataacctcaatagggacaaga
tcggtttctctggaggaataccaggatcctgactttgaaaaggtggaattcataccgtca
ttcagcgtccgggaatacggcatcgaacggttcataaatgacatagagaggaggcccgga
agggtttacatatccatcgatatggacggaatagatccagcgtatgcgcccgctgtggga
acaccggagccattcggccttaccgattatgaggtcaggcggcttgtggagaggctttcc
tacaaggccataggcatggatataaacgaattttccccgctgtacgataacggcaacacg
tccatgctggcgggcaaattaatacaggtcttcatagccagcagggaaaaatacaggata
gagcatatataa

DBGET integrated database retrieval system