KEGG   Thermoplasma acidophilum: Ta1058Help
Entry
Ta1058            CDS       T00037                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tac  Thermoplasma acidophilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tac00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130212..1131123)
Genome map
AA seq 303 aa AA seqDB search
MGDHGDAKDHASELKDIFSLKKIADAKYSYEDSDYVIFGVPFDNTSSYRRGSKYAPDSIR
SAYVNLESFEFSYRFDLLRARISDLGDMEESEDVEYVVDQVDRVTKMVFSDGKIPIMLGG
EHSITVGAVRNFPEDVHMVIVDAHSDFRDSYMGNKLNHACVTKRALEILGPNRITSIGTR
SVSLEEYQDPDFEKVEFIPSFSVREYGIERFINDIERRPGRVYISIDMDGIDPAYAPAVG
TPEPFGLTDYEVRRLVERLSYKAIGMDINEFSPLYDNGNTSMLAGKLIQVFIASREKYRI
EHI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgggagaccatggggatgcgaaagatcatgcttcagaactgaaggatattttttcgctg
aagaagatcgcggacgccaagtacagctatgaagacagcgactatgtgatatttggcgtc
ccatttgacaacacatcaagctacaggcggggctcgaaatacgcccccgattccataaga
tcggcatacgtgaatctggaatcgtttgaattctcctaccggtttgacctgctcagggcc
agaatatcggatcttggtgacatggaagaatccgaggacgtggagtacgttgtcgaccag
gtcgatcgtgtaacgaagatggtattcagcgatggaaagatacctataatgctgggcggt
gaacactccataaccgttggtgccgtcagaaactttcctgaagacgtgcacatggtaata
gtggatgcgcattccgatttcagggattcgtacatgggaaacaaactgaaccatgcctgc
gttacgaaacgcgcgctggagatactgggcccaaacaggataacctcaatagggacaaga
tcggtttctctggaggaataccaggatcctgactttgaaaaggtggaattcataccgtca
ttcagcgtccgggaatacggcatcgaacggttcataaatgacatagagaggaggcccgga
agggtttacatatccatcgatatggacggaatagatccagcgtatgcgcccgctgtggga
acaccggagccattcggccttaccgattatgaggtcaggcggcttgtggagaggctttcc
tacaaggccataggcatggatataaacgaattttccccgctgtacgataacggcaacacg
tccatgctggcgggcaaattaatacaggtcttcatagccagcagggaaaaatacaggata
gagcatatataa

DBGET integrated database retrieval system