KEGG   Thermoplasma acidophilum: Ta1096Help
Entry
Ta1096            CDS       T00037                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ta1096
Enzymes [BR:tac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ta1096
Exosome [BR:tac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ta1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166005..1167471
Genome map
AA seq 488 aa AA seqDB search
MDANGRIVSFAYRLNRQYFPAPGWVEQDPVNLWRNVRITLKKAIEESRIDLTGIASAGVT
NQRETVLVWDRKTGRPLYNAIVWQDKRTSRRIKDLDEETSNSIMKTTGLRPDSYFSASKI
QWLLENVEGLRKKMADGDVSFGTVDSWIIWNLNGSVNRSITVTDHSNASRTMLYDIAKLR
WNPDLLDIFGGISETSLPEVMSSGSAEYGYISKDTSAIFDGREVPITADIGDQQSALFGQ
GCFNPGDVKATYGTGTFILSNAGTEVPQTSGTLLRTIFYSISGRELSYALEGSILASGSV
LRWLQNSLHLFRSAKDIEDAAEKLKSNDGVYFVPAFSGLGSPYWDQDARGLFIGLTESTT
ADHLARSVLESEVYMATDVIMEIEKEIGRNIAKIRCDGGGSRSDFLMQFQADIANAEVLV
PESSETTALGSAYLSGLVSGLWKSKDEIRELWRLKKVYRPVMSEEERKRNYVGWKDAVKR
CMGWHPNI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtggatgctaatgggcgtatcgtctcatttgcctacagattgaacagacagtattttcct
gcgccgggatgggttgaacaggatcccgtgaatctctggcgcaatgtgaggatcacgctg
aagaaggccatagaggaatccagaattgatttgactggcattgcttcggctggcgtgacg
aaccagcgcgagactgtcctcgtatgggatcgtaagactggccggccgctctacaacgcg
attgtatggcaggataaacgaacatccaggaggataaaggatctcgatgaggagacttca
aattcgataatgaaaaccaccgggttgagacctgattcatatttctcggcttcaaagata
cagtggctgctggaaaatgtcgagggccttaggaaaaagatggccgatggtgatgtctca
ttcggaactgtagactcgtggatcatctggaatctgaacggttccgtaaatagaagcatc
accgttacggaccacagcaatgcatccagaaccatgttatatgatatagctaagctgagg
tggaatccagatctgctcgacatatttggtggaatatctgaaacttcgctgcctgaggtt
atgtcgtcaggatctgctgagtacggctacatctcaaaggatacttcagcgatattcgat
gggcgggaagtgcccattaccgccgatataggggatcagcagtcggctctctttgggcag
ggatgtttcaatccaggcgacgtgaaggcaacgtatggaactggaacctttatcctttcc
aatgcaggaaccgaggttccgcagacctccggaactctgctcagaaccatattctattcc
atatctggcagggagttgagttatgcgctcgaagggagcatacttgcatctggatcagtg
ctcagatggcttcagaacagtctccatctattccgatcagccaaggatatagaggatgcc
gcagaaaagctgaagagcaatgatggagtatactttgtcccggcattctccggccttggt
tctccatactgggatcaggacgcgagaggactgttcattgggcttactgagagcacgacc
gccgatcatctggccagatccgtactggaatctgaagtttatatggccaccgacgtgatt
atggaaatagaaaaggagatcggaaggaatatagcgaagataaggtgcgatgggggcgga
tcaagaagcgattttctgatgcagtttcaggccgacattgctaatgcggaggtgctcgta
cccgaatcatcggaaactacggccctgggatcagcttacctatccggccttgtatccggc
ttatggaagagcaaggatgaaatacgcgagctctggaggctcaagaaggtgtataggcca
gtgatgtcagaagaggaaaggaaaaggaactatgtgggatggaaggatgccgtaaagaga
tgcatgggatggcatcctaatatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system