KEGG   Thermoplasma acidophilum: Ta1225Help
Entry
Ta1225            CDS       T00037                                 

Definition
hypothetical protein
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
tac  Thermoplasma acidophilum
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:tac03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:tac03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291045..1291809
Genome map
AA seq 254 aa AA seqDB search
MRAVRALIAFFVFFLIFFTFKFEYVTFLGHRIVILYPDPYDNAGAQFLRLSEYHVLPKDV
ELIALKPTDAMVADIYSVMFLALLFSMPVIVMEAAKFISPGLKKREIQTIRSLGIPAAAL
FAVGSLFGFWYVFPVLFRIFFYFDFAVGSSPTMGIANYTSFFFIYIVSFGLSFEMPVIMV
ALTKLKIVPASFWLRNWRYAVVGSLIFGLVFSPGVLGVSMMIMAIPMMALYFVGAFIAKR
VEKRDQAMYNIAAD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagtacgtgcccttatagctttttttgttttttttcttatatttttcaccttc
aaattcgaatacgttacctttcttggccacaggatagttatactatatccagatccttat
gataatgccggtgcgcagttccttaggctttcggaatatcacgtgcttcctaaagatgtg
gaactaatagcgttaaaaccaacggatgctatggtggctgacatatacagtgtcatgttc
ctggcccttctattcagtatgccagtgatcgtaatggaagcggcaaaattcatttcacca
ggtttaaagaagcgggagatccagacaataagaagccttgggataccggccgcagcactg
ttcgctgttgggagtctcttcgggttctggtacgtttttccagtactgttcaggatattc
ttctattttgatttcgcagttggatcttctccgaccatggggattgccaattacacttca
tttttcttcatttacatagtgtcattcggcctgtccttcgagatgcccgtcataatggta
gcactgacaaaactgaaaatagttccagccagtttctggctgagaaactggagatatgcg
gttgtaggttcgctgatattcggtcttgtattctcgcctggggtacttggcgtgagcatg
atgataatggcaataccgatgatggccctctactttgtcggagcattcatcgcgaaaagg
gtcgagaaaagggatcaggccatgtacaacatcgcggcagattga

DBGET integrated database retrieval system