KEGG   Thermoplasma acidophilum: Ta1311Help
Entry
Ta1311            CDS       T00037                                 

Definition
acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tac  Thermoplasma acidophilum
Brite
Enzymes [BR:tac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ta1311
Transfer RNA biogenesis [BR:tac03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Ta1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359143..1360690)
Genome map
AA seq 515 aa AA seqDB search
MDFFEEMRDVLLSGQIKDKEDLEDVKLELSKKYGLDYVPSDVEILNSFNFSEDVKKILRR
KPTRTISGVAVVAAMTSPERCPHGKCIFCPGGVDNNSPQSYTGYEPAALRGRNNAYDPYM
ETFNRIKQLETIGHDTSKIDLIIMGGTFTARDPAYQRNFVKGCLDAMNGSIGNSLEESIR
INETSRHRCIGLTVETKPDWFFEREIDEALAYGTTKVELGVQNIDDRILAINNRGHTVAD
IARSTQLARDAGLKIVYHIMPGMYGSSFEKDLKSFDLMINDERFKPDMLKIYPTLVTQGT
GLYNLWKNGKYRPYTTAETVDLIVEFMRRMPDWIRIQRIQRDIPVQFIVAGVKRSDIRNL
VERRMREEGIKTGEIRYREIGHGTVKEENVILKVEGYNAGGGKEYFISYVTESNRIIGFV
RLRIPSDRAHRQEVMNTAIIRELKVFGQEVPVGRHEEDEWQHRGFGNRLVQEAERITLEE
GLHRILVISGIGVREYFRKRGYEDLGPYVAKRLSS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttcgaagagatgcgggacgttctactttcaggccagataaaggataaggag
gatctggaagacgttaagctcgagctatcgaagaagtatggccttgactacgtcccgagc
gatgtggaaatcctgaactcattcaatttcagcgaggacgtaaagaagatattacgaaga
aagccgaccagaaccatatcgggtgtggctgtcgttgcggccatgacctccccggagagg
tgcccccatggtaaatgcatattctgtccgggaggcgttgacaacaattctccccagtcg
tatacaggctatgagccggcagcactcaggggtaggaacaatgcctacgatccatacatg
gagacatttaacagaataaagcagctggaaacaatagggcacgacacctcaaagatcgat
ctcatcataatgggtgggacgttcacagccagggacccggcataccagaggaattttgtc
aagggatgcctagacgccatgaacggttcgattggaaacagcctagaggaatcgataagg
atcaatgaaaccagcaggcacaggtgcataggcctgaccgtagagaccaagccggattgg
ttcttcgagcgcgagatagatgaagctctggcctatgggacaaccaaggtagagcttggt
gtacagaacattgatgacaggattctggccataaacaaccgtgggcataccgtggcggac
atagcaagatccacgcagcttgcaagggatgcaggcctgaagatcgtctaccacatcatg
ccagggatgtatggttcaagctttgaaaaagacctgaaatccttcgatctcatgataaac
gatgagagattcaagccggacatgctcaagatatacccaacgctcgtaacgcagggtacc
ggcctttacaatctgtggaagaacggaaagtacaggccatacacgaccgcagaaacggtc
gatctcatcgtggaattcatgcgtagaatgcctgactggataaggatccagaggatacag
agggatattccggtgcagttcatagttgccggtgtgaagagatccgacataagaaatcta
gtggaacgaaggatgagagaggagggcataaagaccggcgagataaggtatagggaaata
ggccacggcacagtgaaggaagaaaatgtgatcctcaaagttgaaggctataatgccgga
ggaggcaaggaatacttcatatcatacgtcacagaaagcaacagaataatcggattcgtg
aggttgagaataccttcggacagggcacacaggcaggaggtcatgaatactgctataata
cgggagctgaaggtattcggccaggaagttcctgtggggaggcatgaagaggatgaatgg
cagcatcgtggcttcggcaataggcttgtgcaggaggctgagcgcatcacgcttgaagag
ggtctccacaggatactggtcatatctggcataggcgtcagggagtatttcagaaagagg
ggctatgaagatttagggccatacgtcgcgaagaggctatcatcgtaa

DBGET integrated database retrieval system