KEGG   Thermoplasma acidophilum: Ta1323Help
Entry
Ta1323            CDS       T00037                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tac  Thermoplasma acidophilum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tac00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tac00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tac00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1370890..1372341)
Genome map
AA seq 483 aa AA seqDB search
MFPKGFKFGFSEAGFQFEMGISDPDPNTDWYVWTHDKYNIQNHVVSGDLPENGAGYWDLY
HRDHDFAQHLGMNAARIGIEWSRIFPKSTEEVKVSVQNDRGDVLNVDITDRDLDKLDKIA
NKDAVNHYRSIFSDFKNRGNYLIINLYHWSTPVWINDPSKRDIEKDNAVGNCFTTRSIVE
FAKFAAYVARAFDDLADRWSTMNEPNILFNGQCSNDWRPDSMAIRKKLFAEAHARAYDSI
KKFSEKPVGIVYANGDMQPLTDEDREARDLAEYEIRYSFFDAITKGDLSWYANAAQNRSL
DYSSDKREDMANHLDWVGVNYYSRDVVKKDGDRWAIVPGYGYATGENKRSLDGRSSSDTG
WEVYPEGIYHLVMSYQKHIGLPMMISENGVADDSDRLRPRYVASHLKNLESAIRDGAKVE
GYLHWALTDNYEWASGFSKKFGLLKVDFKTKKRYIRPGALVFKEIVENNGVDEDLEWLAA
DKF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcctaaaggctttaaatttgggttttcagaggcagggtttcagtttgagatggga
ataagtgatcctgatcccaatacagactggtatgtatggacgcacgataagtataacatt
cagaaccatgtggtttctggagatctgcctgaaaacggtgcaggttactgggatctatac
cacagggatcatgatttcgctcagcatctgggaatgaatgcagctagaataggtatagaa
tggtcaagaatatttccaaaatcaactgaggaagttaaggtcagtgtacaaaatgacagg
ggcgacgtgctgaatgttgatatcacagacagggatcttgacaaacttgataagattgca
aataaagatgccgtgaatcactatagaagcatattctcggatttcaagaatcgcggaaat
taccttatcatcaatttgtaccattggtccactccagtgtggataaacgacccgtcgaag
agagatatcgaaaaggataatgcagttggaaattgctttacaacacgctcaattgtggaa
tttgccaagtttgcggcttatgttgccagggcgttcgatgatcttgctgatagatggagc
acgatgaatgaaccaaatatacttttcaatggccagtgcagcaatgactggagaccggac
tctatggcaatacggaaaaagctgttcgcagaagcccatgcaagggcatatgacagcata
aaaaaattttcagagaaacctgttggcatagtgtatgccaatggagatatgcagccattg
actgatgaggacagagaggcaagggatcttgcagagtatgaaataagatactcgttcttc
gacgccataaccaagggagatctatcgtggtatgcaaatgccgcgcagaatcgttctctg
gattatagctctgataagcgggaggatatggcgaatcatcttgactgggtgggtgttaac
tattacagcagggatgttgttaaaaaagacggtgacagatgggccatagtacctggatat
gggtatgcaactggcgagaacaagaggtctcttgacggaagatcctccagcgacaccggc
tgggaagtgtatcctgaaggaatataccatctcgtcatgtcctatcagaagcatatcggg
cttccgatgatgatatctgaaaatggagttgcggacgatagcgacagactgaggcccaga
tacgtggcatcccatctgaagaatctcgaaagtgcgataagagacggtgcaaaggttgag
ggctacctgcattgggcattgacagacaattatgaatgggcatcaggattttccaagaaa
ttcgggcttctcaaggtagactttaaaacaaagaagagatacatcaggccaggtgcgctt
gtttttaaagaaatagttgaaaataatggagtcgacgaagatctggaatggcttgccgca
gataaattctaa

DBGET integrated database retrieval system