KEGG   Thermoplasma acidophilum: Ta1323Help
Entry
Ta1323            CDS       T00037                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tac  Thermoplasma acidophilum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ta1323
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ta1323
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ta1323
Enzymes [BR:tac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Ta1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1370890..1372341)
Genome map
AA seq 483 aa AA seqDB search
MFPKGFKFGFSEAGFQFEMGISDPDPNTDWYVWTHDKYNIQNHVVSGDLPENGAGYWDLY
HRDHDFAQHLGMNAARIGIEWSRIFPKSTEEVKVSVQNDRGDVLNVDITDRDLDKLDKIA
NKDAVNHYRSIFSDFKNRGNYLIINLYHWSTPVWINDPSKRDIEKDNAVGNCFTTRSIVE
FAKFAAYVARAFDDLADRWSTMNEPNILFNGQCSNDWRPDSMAIRKKLFAEAHARAYDSI
KKFSEKPVGIVYANGDMQPLTDEDREARDLAEYEIRYSFFDAITKGDLSWYANAAQNRSL
DYSSDKREDMANHLDWVGVNYYSRDVVKKDGDRWAIVPGYGYATGENKRSLDGRSSSDTG
WEVYPEGIYHLVMSYQKHIGLPMMISENGVADDSDRLRPRYVASHLKNLESAIRDGAKVE
GYLHWALTDNYEWASGFSKKFGLLKVDFKTKKRYIRPGALVFKEIVENNGVDEDLEWLAA
DKF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcctaaaggctttaaatttgggttttcagaggcagggtttcagtttgagatggga
ataagtgatcctgatcccaatacagactggtatgtatggacgcacgataagtataacatt
cagaaccatgtggtttctggagatctgcctgaaaacggtgcaggttactgggatctatac
cacagggatcatgatttcgctcagcatctgggaatgaatgcagctagaataggtatagaa
tggtcaagaatatttccaaaatcaactgaggaagttaaggtcagtgtacaaaatgacagg
ggcgacgtgctgaatgttgatatcacagacagggatcttgacaaacttgataagattgca
aataaagatgccgtgaatcactatagaagcatattctcggatttcaagaatcgcggaaat
taccttatcatcaatttgtaccattggtccactccagtgtggataaacgacccgtcgaag
agagatatcgaaaaggataatgcagttggaaattgctttacaacacgctcaattgtggaa
tttgccaagtttgcggcttatgttgccagggcgttcgatgatcttgctgatagatggagc
acgatgaatgaaccaaatatacttttcaatggccagtgcagcaatgactggagaccggac
tctatggcaatacggaaaaagctgttcgcagaagcccatgcaagggcatatgacagcata
aaaaaattttcagagaaacctgttggcatagtgtatgccaatggagatatgcagccattg
actgatgaggacagagaggcaagggatcttgcagagtatgaaataagatactcgttcttc
gacgccataaccaagggagatctatcgtggtatgcaaatgccgcgcagaatcgttctctg
gattatagctctgataagcgggaggatatggcgaatcatcttgactgggtgggtgttaac
tattacagcagggatgttgttaaaaaagacggtgacagatgggccatagtacctggatat
gggtatgcaactggcgagaacaagaggtctcttgacggaagatcctccagcgacaccggc
tgggaagtgtatcctgaaggaatataccatctcgtcatgtcctatcagaagcatatcggg
cttccgatgatgatatctgaaaatggagttgcggacgatagcgacagactgaggcccaga
tacgtggcatcccatctgaagaatctcgaaagtgcgataagagacggtgcaaaggttgag
ggctacctgcattgggcattgacagacaattatgaatgggcatcaggattttccaagaaa
ttcgggcttctcaaggtagactttaaaacaaagaagagatacatcaggccaggtgcgctt
gtttttaaagaaatagttgaaaataatggagtcgacgaagatctggaatggcttgccgca
gataaattctaa

DBGET integrated database retrieval system