KEGG   Thermoplasma acidophilum: Ta1332mHelp
Entry
Ta1332m           CDS       T00037                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tac  Thermoplasma acidophilum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta1332m (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ta1332m (sucC)
   00640 Propanoate metabolism
    Ta1332m (sucC)
   00660 C5-Branched dibasic acid metabolism
    Ta1332m (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ta1332m (sucC)
Enzymes [BR:tac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ta1332m (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1381080..1382177)
Genome map
AA seq 365 aa AA seqDB search
MNLYEYMGKDIFRQYGIPVPNGYVVSSVDEVRKLTNPVAVKSQILLGGRGKAGGIKFAKT
DQELKDAVKALLGAKVRNLTVTKVLIEDMLNIKHEYYVSITLNRSARAPTVIASAMGGVE
IETVPDEKIFKRIIDPSLGYSDFIGREASTFMGLSPDLSKQFLDLLKKLYNVYKGEDAEL
VEINPLVETNDGKLIAADAKVVIDSDAMFRHREFNIQDPEKTPLELKAEGKGYAFVELDG
DIGVIANGAGLTMATLDALLLHKGKPRNFLDLGGTDNVDIVVNAFDLVLEAKPKAILVNI
FGGVTKCDTVAQGIVDAKKKFDIKIPIVVRLSGIHEEEGRQILKENGIEAFSEMMPAIER
VTKVF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctttatgaatacatggggaaggacatcttccgtcagtacggaatacctgtaccc
aacggatatgttgtttcaagcgtagatgaggtcagaaaacttacaaaccctgtggctgtg
aaatcgcagattctcctaggaggcaggggaaaggcaggaggcataaagttcgctaagacg
gatcaagagctcaaagacgctgtgaaagcacttctgggagcaaaggtaaggaatctgacc
gtgaccaaggtgctcatagaagatatgctgaacataaagcatgaatattacgtgagcata
acgctaaacagatcagcaagagcaccaactgtaatcgcaagtgccatgggtggtgttgag
attgaaacggttccggatgagaaaatattcaagaggataatcgatccatcgcttggatat
tcggacttcataggaagagaagcgtccacttttatggggctgagcccggatctgtcaaag
cagtttctggatcttctgaagaagctgtacaatgtctacaaaggcgaggacgccgagctt
gttgagattaacccgctggtggagacgaacgatggcaagctcatagctgcagatgccaag
gttgtgatagactccgatgcaatgttcaggcacagggaattcaacatacaggatccggaa
aaaacacctctggaactgaaggccgagggcaagggctatgcctttgtggagcttgacggg
gacattggtgtgatagcaaatggtgctgggctcaccatggccacactggatgcgcttctg
ctgcataagggcaagccgaggaactttctggatcttggcggaacagataacgttgacata
gttgtgaatgcgttcgatcttgtgcttgaagccaagccaaaggccatactggtcaatata
tttggaggagtcacgaaatgcgataccgtggctcagggcatagtcgatgcgaagaagaag
ttcgacataaagataccaatagtagtaaggttgagcgggatccatgaggaggaaggcagg
cagatcctgaaggagaacgggattgaggcgttttccgagatgatgccagccattgaaagg
gtcacgaaggtgttctaa

DBGET integrated database retrieval system