KEGG   Thermoplasma acidophilum: Ta1508mHelp
Entry
Ta1508m           CDS       T00037                                 

Gene name
acsA
Definition
(RefSeq) acyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tac  Thermoplasma acidophilum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ta1508m (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ta1508m (acsA)
   00620 Pyruvate metabolism
    Ta1508m (acsA)
   00640 Propanoate metabolism
    Ta1508m (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ta1508m (acsA)
   00680 Methane metabolism
    Ta1508m (acsA)
Enzymes [BR:tac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ta1508m (acsA)
Lipid biosynthesis proteins [BR:tac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ta1508m (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1561593..1563164)
Genome map
AA seq 523 aa AA seqDB search
MGFNFVRDVIEKNDRRKTALIVSDPELNSRSETYGTLLKKSYKLANFLYEMKVRPGNRIM
IMMENSLEIYHAVTASIALGAVYAPTASILPDSQIKYRIDHLNPKAIFSDSGSYDKLKGY
GYTVVNLEDPDTAKEIDGYQETFSRFYDDPDAEHVIFFTSGTEGNPKMVLHNNTYPLGHR
TTVRWLDLRAQDTHWNISSPGWAKWGWSSYYSPMISGSTVFNMRYRKFDPEVALKAMEKF
LITSICAPPTVWRMFLLQDLSSMNLHLRKAASAGEPLNPEIIDRIRQYLGVTVKDGYGQS
ESTLMVGNLEKQTVKPGSMGRPLDPYRVVIVDDAGNRLPPNTTGHIAVDIGERPNGLFVS
YMNDPSLTRDRFRNGLYYTGDMGYMDEDGYLWFVSRSDDVIKSSDYRIGPFEVESALLRH
PAVAESAVVGTPDEIRGDLVKAFVVLKSGYTPSQDLARELSIHVRNLVGPHARPRKIEFV
GELPKTISGKIIRKELRKLELEKYNKAKSDPSSKGLGYEFYVD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcaacttcgttagggacgtcattgagaagaatgacaggaggaagactgcgctg
atcgtttcagatccggaactgaattccagaagcgaaacttacggcaccttacttaaaaaa
tcatacaaactcgcaaactttctgtacgaaatgaaggtcaggcctggaaacaggataatg
ataatgatggaaaattcactggagatctaccatgcggtgacggcatcgatagcgctgggc
gcggtatacgcaccaacggcatcaatacttccggattcccagataaagtacaggatcgac
catcttaacccgaaggcgatcttttcggacagcggatcatacgataaattgaagggatat
ggatataccgtggtgaatcttgaagatccagacacggctaaggaaatagatgggtatcag
gagaccttctccagattctacgacgatcctgacgcagaacacgtgatattcttcacctcc
ggcacagagggcaatccaaagatggtcctccacaacaacacatacccactcggccacagg
acaacggtgagatggctcgacctcagggcacaggatacgcactggaacataagcagtcct
ggatgggcaaagtggggctggtcctcttactattccccaatgatctccggttcaacggta
ttcaacatgcgatacagaaagttcgatcctgaagttgcactgaaggccatggagaagttt
ctgataaccagcatatgcgcaccgccaactgtgtggcgcatgtttctgctgcaggatctg
tcatctatgaatctgcacctgagaaaagcagcctcagctggagaacccctcaaccctgag
ataatagatcgtataaggcagtatctgggcgtgaccgtcaaggatggatacgggcaatcc
gaatcaacgctgatggtgggcaaccttgagaaacagacagtcaagccgggatctatggga
aggccgctcgatccatacagggttgttatagtggatgatgcggggaacaggcttccgccc
aacacaacaggccatattgcagttgacatcggcgaaaggccaaacgggctcttcgtctca
tacatgaacgatccgtcgctgacacgcgatcgcttcagaaatggtctgtattacacaggt
gatatgggctacatggatgaggatggctatctgtggtttgtttcaagatcagacgacgtt
ataaagtcgtccgattacaggatagggccattcgaggttgagtctgctctcctcaggcat
ccagccgttgcagagtctgcggtagttggcactcccgacgagatcaggggagaccttgtc
aaggctttcgtcgtgcttaaatcaggctacactccgtctcaggatcttgccagggaactg
agcatccatgtcagaaacctggttggcccgcacgcaaggccaagaaagatagagtttgtg
ggcgaactgccgaagaccataagcggaaagataatacgcaaggaactcagaaaattagaa
cttgaaaaatataataaggcgaagagcgatcccagcagcaaagggctgggatacgagttc
tacgtggattga

DBGET integrated database retrieval system