KEGG   Trichoplax adhaerens: TRIADDRAFT_13664Help
Entry
TRIADDRAFT_13664  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
tad  Trichoplax adhaerens
Pathway
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    TRIADDRAFT_13664
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    TRIADDRAFT_13664
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     TRIADDRAFT_13664
Cytochrome P450 [BR:tad00199]
 Cytochrome P450, animal type
  CYP3 family
   TRIADDRAFT_13664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 475 aa AA seqDB search
FVIYLIYRFLIAPYLNIKKLGLPFPRPRPMVGNLFDFGPGNQHVAQMEWGKRYGRVYASL
FFQIPTIWIGDPDMIKSVMVKEFSNFTNRFPVTKTLHPFDKSILELKDQDWKRMRNILIP
TFTTSKLKLILPFISEASDILIDTLITADEEGKIIDLWQASGHYTMKVILATSFGIQIES
EKQEEKLMNAAGALFRSDPGILQVLMIISPRVFSALEPKFGGPLVSSINYIIHLTKQVIN
ERRRNIHAGVTCRRDLIQQMIEAGDNDKLNDDEIIAQAFIFLTAGYETTQNTLAFACYLL
GTNPRVQQKLIDEIDSKCPDVNSVSYDIITNLPYLEMIVSETLRLYPPAHFINRDVKQDT
TINGVHIPKGVMIGFPVYSIHHDPQFWSNPDDFIPERFMPEEKVKLVPYSYIPFGGGPRN
CIGMRLALLEVKLALVKLMQKVKFTTVKETEIPLKLKGLSSLSPLNGIRLGIDRR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
tttgttatctatttaatttatagatttcttattgctccttacctgaacataaaaaagcta
gggctaccatttccccgtcctaggccaatggtgggtaatcttttcgattttggccctggt
aatcaacatgttgctcagatggaatggggtaaacggtacggaagggtttacgcttcctta
ttttttcaaatcccaactatttggataggcgatcctgatatgatcaaatccgtcatggtg
aaagaattctcaaactttaccaatcgatttccagtgactaaaacattacatccttttgat
aagtctattctggagttaaaagatcaagattggaaacgtatgagaaatatattaattcct
acatttacaacctcaaaactaaaattaatactaccatttatatcggaagctagcgatatc
ctcattgatacactgattacagctgatgaagagggtaaaatcattgatttatggcaggca
tccggtcattatactatgaaagttatccttgcaacttcctttggtattcagattgaatcg
gaaaagcaggaagaaaagctaatgaacgcagctggggcactctttcgatctgatcctggc
atattacaagttctcatgattatttcccctcgagtattctctgctttagaaccaaaattc
ggcggacctctagtatcttccataaactatattattcacttaactaaacaagttatcaac
gagcgaaggaggaatatccacgctggcgtaacatgccgtcgcgacttaatacagcaaatg
atagaagctggtgacaatgataaattaaatgatgatgagattatagctcaggcatttatt
tttcttacagccggttatgaaaccactcaaaatactttagcatttgcttgctatttattg
ggtacaaatcctagagtgcagcagaagttaatagatgaaatcgattccaaatgtcctgat
gtaaattcggttagctacgatattataactaatctaccttacttagaaatgattgtctct
gaaacattaagattgtatcctccagcacatttcattaatcgagacgttaaacaagataca
acaattaatggcgttcatattcctaaaggggttatgattggtttcccagtatattccatc
catcacgatccccaattttggtctaatccagacgattttattcctgagagatttatgcca
gaagagaaagtaaaacttgtaccttacagctatattcctttcggtggtgggcctcgtaat
tgcattggaatgcgtttagcattactagaggtcaaattagccttagtaaaattaatgcaa
aaggttaaattcacaacagttaaagagaccgaaattccgcttaaattaaaggggttgtca
tcactttctccacttaatggtattcgtttaggcatcgaccgtcga

DBGET integrated database retrieval system