KEGG   Trichoplax adhaerens: TRIADDRAFT_15859Help
Entry
TRIADDRAFT_15859  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tad  Trichoplax adhaerens
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tad00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 297 aa AA seqDB search
PEEPLQSDCCGQGCNPCVFDIYESDIAKWKKKCRRILNNEEDFLEDTTKNCRLAGIVLDQ
FTSLQIISIQKITEKLITYRFKLPNNKPLNLNPGQHLLLAHKANDFMLTRQYTPISSVDT
VGYFDVFIKIYDNGKMSDQIRQWHVGDYAMWRGPYGDFQYLPNQCKKILMLAAGTGVAPM
IQIIRYVINNENDDTLLHLILSVKYYDDIALKHDLDAFKQYWNVTVEYVLTCEKDTKKFK
YGDKITLSKVDHQFLEKVLFPPSQNSKVLICGTKSFEKDMIKYLKQFGFTEENYFKF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
cctgaggaaccattgcaaagtgattgttgtggtcaaggttgtaatccttgcgtcttcgat
atctatgaaagcgatattgcaaagtggaagaagaaatgccgtcgtattcttaataatgaa
gaagattttctggaagatactacgaaaaattgtcgtctggcaggcatagtgcttgatcaa
tttacatctttacagatcatatccatacaaaagattactgaaaaattaattacttatcga
tttaaattgcctaataataaaccactgaatttaaatcctggtcagcatttgctattagcc
cataaagctaacgattttatgcttacgcgtcaatatacaccaataagttccgttgatacc
gttggatatttcgatgtttttatcaaaatttatgataacggtaaaatgtcagatcagatt
cgacaatggcatgtaggagattatgctatgtggagaggaccttatggcgattttcaatat
ctgcccaatcaatgcaaaaagatattaatgctagcggctggaactggtgttgcgccgatg
atacaaattatacgctatgttatcaataatgagaacgatgatactctacttcatttaatt
ttatccgtcaagtattatgacgacatagctttaaaacatgacctagatgctttcaagcag
tattggaatgtaactgtcgaatacgttctaacttgcgagaaagatacgaaaaaattcaaa
tatggtgataaaattacgcttagcaaggttgatcaccaatttcttgaaaaagtcttattt
cctccatctcaaaattctaaagtgcttatatgcggaacaaaatcattcgaaaaagacatg
ataaaatatttaaagcaattcggctttactgaagagaattattttaaattt

DBGET integrated database retrieval system