KEGG   Trichoplax adhaerens: TRIADDRAFT_18730Help
Entry
TRIADDRAFT_18730  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
tad  Trichoplax adhaerens
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tad00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TRIADDRAFT_18730
   04142 Lysosome
    TRIADDRAFT_18730
Exosome [BR:tad04147]
 Exosomal proteins
  Proteins found in most exosomes
   TRIADDRAFT_18730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 490 aa AA seqDB search
LKDQGILAKDVGFNALTIPSDRFICARQQTEPNQSQFIVLDLASPMQKIPLICPTLTESA
IMNPVIKVIAIKEGQKLQTFDLEMKICLKTIFLQEYTTFWKWISVNVIALVTQTKVYHWS
MEGNTQLNEIHARHQALNGYQIINYHVDHTKKWSLLIGIRVQNHRVLGVLQLYNTETKIS
QLIEGHVAAFASVKLGDNYEPSNLLIIGTRRLKGGTLRILEIGDPPLNNEPFQEQTLELL
FPSEIQNDFPVCLQINEKHGLIYLITKYSYLHVCTIESMQCIYMGKLSNANTFAATLDTS
SHGILSVDDNGQVFSTSMNTENIVPYIINTLQNKALARKVALRCNLSGAEDLFIEEFNQL
FDSGEYVAAAKIAVSAPKGVLRTSQTIQRFQQHIPRTTTALAIYFDVLLRQGKLNRYESL
ELSKRLIHTGKNQALEHWLKQAKLENSEELGDLLRSSNPVTASSIYLAIQKPKKVIINAL
FRLIIAIIRK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ctaaaggatcagggaatacttgcaaaagatgttggatttaacgcattaactataccatcg
gataggtttatatgtgctcgtcagcaaacggaacctaatcaatcgcagttcattgtcctt
gatttagcttcaccaatgcaaaaaattccattaatttgtcctacattgactgagtccgct
attatgaatccggtgattaaagtcattgcaattaaagagggtcaaaagcttcaaacattt
gatttagaaatgaaaatttgtttgaaaacgattttcctccaggaatatacgacattctgg
aagtggatttctgttaatgttatagccttagtcactcaaacaaaagtatatcactggtct
atggaagggaatacccaactgaatgaaatccatgctaggcatcaagccttaaacggttac
caaatcattaattatcacgtcgatcatactaaaaagtggtcattattgattggtattaga
gtgcaaaatcatcgagttcttggtgttctacaactttacaataccgaaacgaaaataagt
caattaattgaaggacatgtagcagcttttgcttccgtaaaactgggggataattatgaa
ccttcgaatctattaatcattggtactcgtcgtctcaaaggtggaacgctacgcattttg
gagattggagatccacctcttaacaatgaaccattccaggaacagacattggaactactt
tttccttcagaaattcaaaatgactttcccgtctgtcttcagataaacgaaaaacatggt
ctaatatatctaattactaaatatagttatctccatgtgtgcactattgaatctatgcag
tgtatttatatgggtaagttaagcaacgcaaatacctttgctgcaacgttagatacatca
tctcatggcattttaagtgtcgacgataatgggcaggttttttctaccagcatgaataca
gaaaatatcgtgccctacattatcaataccctccaaaataaggccctggccagaaaggtg
gcactccgttgcaatttaagtggtgctgaagatctttttatcgaggaatttaatcaacta
tttgacagtggtgaatatgtagcagctgcaaagattgcagtctcagcgccaaagggcgtc
ttaagaacatcacaaactattcaaagatttcaacagcatattccaagaacaactaccgct
ttagcgatatattttgatgtcttattaaggcaaggcaagctgaatcgttatgaatcactt
gaattatccaagcgattgattcatactggcaagaatcaggctttagaacattggctgaaa
caagcaaagcttgaaaatagcgaagaattgggagatttacttaggtcatcgaatcccgtt
actgcatcttccatttatcttgctattcaaaaacctaaaaaagtaattattaatgccttg
tttcggcttataattgcaataattagaaagtaa

DBGET integrated database retrieval system