KEGG   Trichoplax adhaerens: TRIADDRAFT_1914Help
Entry
TRIADDRAFT_1914   CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRIADDRAFT_1914
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     TRIADDRAFT_1914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 540 aa AA seqDB search
ILIIALLPYSNTQIIIPTTTGLVSGKIVNTNGVDQFAYLGIPYAQPPVDQLRFKPPVPID
QWSGILNATGYKNSCPQQTPISLLDPNSTEMQISEDCLYLNIFTPNPSSAGNRSVLIWIH
GGGFSYGTGSWWQGQMLSANEDIVVVTMNYRLGIFGFMTSGEKDVNQRSIPANLGLQDQN
SALKWINDNIENFGGNKDQITIAGNSAGAVAVANHLVMPSSNGLFRRAIIQSAVFRDSPS
YYKAKLTSEFTLSDANKFFAQYSMAAKCYKNTTIETVNCLKALSIQQLLQIQMRFSGSNP
YFPVVDGDIIPESTYKAFASGKFEKADIMIGTMLNDGYFFLLFLPNISHGISRNQFKNYI
NTNFPAASERIKLSIQYQYTDWANISSPVVNRDRYGDMYNDYFFSVPSENYAEVFSRYVP
TYLYIFAHRTAGTSMPAFVKAVHTLEISYVFGYPLDPPANFPEKFDDTDRQVCRQVMSYW
GNFIRQGNPSDSTSALAWPRYEQTSKDYMWIAPKLAIKKNYYSKQVAFWNQYLPQLATLT
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atattaatcattgctttactaccttattctaacactcaaattatcattcctactacaact
ggtttagttagtggtaaaatagtgaacacgaatggcgttgatcagttcgcctatctcggc
attccttacgctcaaccgcctgtcgatcaactacgatttaagccaccagtaccaatagat
caatggtctggcattttaaacgctacaggttataaaaatagctgccctcaacaaacaccc
atatctcttttagatccaaattcaactgaaatgcaaatcagtgaagattgtctttacctc
aacattttcacacctaatcctagtagtgccggaaataggtcagtactcatatggatacat
ggcggtggattcagttatggaaccggctcatggtggcaagggcaaatgttgtctgccaac
gaagatatcgtcgtggttacaatgaattaccgacttggaatctttggttttatgacatca
ggtgaaaaggatgtaaatcaaagatctattccagcaaatctaggtttacaagatcaaaat
tcagccttaaaatggattaacgataatatcgaaaatttcggaggcaacaaagatcaaatt
acaatagcaggcaactcagctggagctgttgctgttgccaatcacctagttatgccatct
agtaatggattgtttaggcgtgctatcatacaaagcgcagttttcagagattcaccatcc
tattataaagctaaattgacatctgagtttacactttccgatgcaaacaaattctttgca
caatatagtatggcagccaaatgttataaaaacacaacaatagagactgtaaattgttta
aaagctttatcaatccaacaattattacaaattcaaatgaggttttctggaagtaatcca
tatttccccgttgttgatggtgacataataccagaatcaacttataaagcttttgcttca
ggaaagtttgaaaaggccgacattatgataggcacaatgctaaatgatggctattttttc
ttattatttctgcctaatatttcacatgggatctcacgaaatcagttcaaaaactacatt
aatactaattttccagcagcaagtgaacgtataaaactatctatccaatatcaatatacc
gactgggctaatattagctctccagtcgtaaatagagatcgatatggcgatatgtataat
gactatttctttagcgtgcccagtgaaaattatgcagaagtattttctcgatatgtacca
acctatctctatatatttgctcatcgaactgcaggaacttcgatgccagcatttgttaag
gcagtacacactttagagatctcctatgttttcggctatccattagatccacccgcaaat
tttccagaaaaatttgatgatactgatcgacaagtatgccgacaggttatgtcatactgg
ggcaacttcattcgtcaagggaatccgtcagattcaacctctgcactcgcctggccaaga
tatgaacaaacaagcaaagactacatgtggattgcacctaaattagcaattaaaaaaaat
tactacagtaagcaagttgcattttggaatcaatatcttccgcaactggctacactcaca

DBGET integrated database retrieval system