KEGG   Trichoplax adhaerens: TRIADDRAFT_19344Help
Entry
TRIADDRAFT_19344  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tad  Trichoplax adhaerens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRIADDRAFT_19344
Enzymes [BR:tad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TRIADDRAFT_19344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 244 aa AA seqDB search
MSVLLNGEKSYVDEKKEDEQSTLSIDKKRQGNNKNEFNKNVDQIAQVSNIVINSKQEEKI
LHSLEQSYYSILNTIPGEDVTRQGILKTPSRAAKAMFYFTKGYRDNLNELINDALFNVDH
DEMVIVKDIEFFSLCEHHLVPFYGKVHVGYLPNRQVVGLSKIARIIEMYSRRLQVQERMT
KQIAEAVTTAINPTGVGVVIEGTHMCMVMRGVQKTGSKTTTSTMIGVFREDPRTREEFLS
LIRH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcctacttaatggtgagaaaagctacgtcgatgagaaaaaagaagatgaacag
agtactttatctatagataaaaaacgccaaggaaataacaaaaacgagtttaataaaaat
gtggatcaaatcgctcaagttagcaatattgttatcaactccaaacaggaagagaaaatc
ttacattccttggagcagtcctattactcaatattaaatactatccctggtgaagatgtc
actagacaggggattttgaaaacaccaagtcgtgctgccaaagcgatgttttattttacc
aaaggatatagagataacctgaacgagctgattaatgatgcactatttaatgttgatcac
gacgaaatggtcattgttaaagacatcgaatttttttcattatgcgaacatcatttggtt
ccattttacggcaaggttcatgtaggctatttaccaaatagacaagttgttggtttaagt
aaaattgcaagaatcattgaaatgtatagcagacgattacaagttcaagaaagaatgacg
aagcaaattgctgaagcagtaactaccgcgatcaatccaacaggcgttggtgtagttata
gaaggaactcacatgtgtatggtcatgagaggagttcaaaagaccggtagtaaaacaact
accagtacaatgattggagtatttcgagaagatcctagaacaagagaagaatttctatcc
cttatcagacactaa

DBGET integrated database retrieval system