KEGG   Trichoplax adhaerens: TRIADDRAFT_20144Help
Entry
TRIADDRAFT_20144  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tad  Trichoplax adhaerens
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRIADDRAFT_20144
Enzymes [BR:tad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TRIADDRAFT_20144
Glycosyltransferases [BR:tad01003]
 Polysaccharide
  Storage polysaccharide
   TRIADDRAFT_20144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 637 aa AA seqDB search
MKLQLTGGDVSGLRPYVFETAWEVVNKVGGIYTVIKTKAGVTVEELGDHYYLLGPYNEQS
VRTEVEVIQPENKVIADVVASMREKGVKVIVGRWLIDGYPQVILFDINSHRHALEAWKKE
LWDKTHISTNVVDSETDNAILFGFIVTWFLSEFRQRVAEDALVIAHFHEWLSAVGLIMTK
MKSLDVATLFTTHATLLGRYLCAGQVDFYNNLPHFDVDKEAGDRGIYHRYCLERAGVSLA
DIFTTVSQITAVEAEHLLKKKPDVVTPNGLNVVQFSALHEFQNLHAKSKDKIHEFIRGHF
HGHFNFKLDKTLYFFIAGRYEYFNKGADMFIESLARLNYMLQSSGSDYTVVAFIIMPTKT
NNFNVDSLKSQASTKQLREIVNHIQGKMGAKLFEKALMGEIIDGKDLLDKDDFLQLKRCI
YAAQRPQLPPVVTHNVVDSDGDLVLNHIRRVRLFNDHNDRVKVIFHPEFLSPTNALFSID
YEEFIRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGSFMGEHLRDPSSYGIYI
VDRRYKGVDESIQELADILFDFCKMSRRQRIIQRNRTERLSDMLDWKSLGIYYKKARYQA
LRKKHPEAFLLLSDEDTGVSIFFRMVSAVVFASTYSY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacagttaactggaggcgacgtttctggtctacgtccgtatgtttttgaaacc
gcttgggaagttgttaataaagttggtggcatttatacggtaattaagactaaagccggt
gtgacagtggaagaactgggcgatcactactacttgcttggcccttataatgaacagagt
gtacgaactgaggtagaagttattcagccagaaaataaagtaatcgctgatgtggttgct
tctatgcgtgaaaaaggtgttaaggtgatcgttggcagatggcttatagatggttatcct
caggtaatcctatttgatatcaattctcatcgccatgccttagaagcctggaagaaggaa
ttatgggataaaacacatatcagtaccaacgttgttgactcagaaactgataatgcaata
ctatttggttttatagtaacctggtttcttagtgagtttcgccagcgcgtagctgaggat
gctttggttattgcacattttcatgaatggttgtcggcagttggtttgataatgaccaaa
atgaaatctctggatgtagccacattgtttactactcatgcaactttacttgggcgttac
ttgtgcgccggccaggttgatttctataataatctacctcattttgacgttgataaggaa
gctggcgatcgtggtatttatcatcgttactgcttagaacgtgctggagtatcattagct
gacattttcaccaccgtatcacagattacggctgtagaagcggaacatttactgaaaaag
aaaccagatgtcgtcactccaaatggacttaatgttgtgcaattcagtgcgctacacgaa
ttccaaaaccttcatgcaaaatctaaagataagattcatgaatttattcgtggtcacttt
cacgggcatttcaattttaaattagacaagactctgtatttctttattgctggaagatac
gaatatttcaataaaggtgctgacatgttcattgaatcgcttgctcgattaaattacatg
ttgcagtcatctggaagtgattacactgttgttgcattcatcatcatgcctactaaaaca
aataatttcaacgttgattcccttaaaagtcaggcttctaccaagcagttaagagaaatt
gttaatcatatacaaggcaagatgggagcaaaattgtttgagaaagctttaatgggcgaa
attatagatgggaaagatttacttgataaagacgactttttacaattaaagcgatgtatt
tatgctgcgcaaaggccacaactaccacctgttgtaacgcacaatgtagtcgatagtgat
ggtgacttggtattaaaccatattagaagagttagattattcaacgatcacaatgataga
gtaaaggttattttccatcctgaattcctgtcaccaacaaatgcattattttccattgac
tacgaagaatttatacgaggctgccatcttggtgttttcccttcctactatgagccgtgg
ggttatacaccagctgaatgtaccgtgatgggcattccttcagtaaccacgaacttgtca
ggttttggtagctttatgggagaacatttaagagatccttcctcttacgggatttatatt
gtggatcgtcggtataaaggcgtcgatgagtctattcaggaactggctgatatactattc
gatttctgtaaaatgtcgaggagacaacgcataatccaaagaaatcgtactgaacgttta
agtgatatgcttgattggaaaagtctcggaatttactacaagaaagctcgctatcaagct
ctcagaaagaagcatccggaggcatttctattacttagcgatgaagatactggggttagt
attttctttaggatggtatctgctgtagtatttgcaagcacttacagctattaa

DBGET integrated database retrieval system