KEGG   Trichoplax adhaerens: TRIADDRAFT_20428Help
Entry
TRIADDRAFT_20428  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tad  Trichoplax adhaerens
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TRIADDRAFT_20428
  Replication and repair
   03420 Nucleotide excision repair
    TRIADDRAFT_20428
Transcription machinery [BR:tad03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TRIADDRAFT_20428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 452 aa AA seqDB search
MKTQELLTLQGLHQYLKSLPAIILDKLYNHPAACLATFRELSQLAKHYVMRTLFTIQAIP
TSTISAWVNSQHQKEHQAALNQLTEIRIWQSHTLPGGMQGIKLNESFRANLKTALCGGGE
SWYGPQLSKADKYQFTSEALDLKSKERWECVLHYLVGAGEDLALSGEIQSLLNNCGLVSK
NGITAAGFQFLLLDRPSQVWYILLQYLDSAESLGMDLVEILSFLFQLSYSTFGQNYSTEG
LTQTQLTCLQHMREIGLVVQRKRKDMKFYPTQLAINLASGAKQEELDHSKSSGYIIVETN
YRLYAYTESPLDIALVALFCEMMYRLPGLCVGLITRESVQQAFTNGITANKIINFIRTHA
HPEAKKKVTTPIVPSTIIDQLYLWELERGRLSCSDGVLYNQILSSSDFEALRKYADDMGV
LLWASPAKRLLVVNRDGHNHVKHFWKRNKQKD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcaggaattgctgacattacagggcctacaccaatatctaaaaagtttacct
gcgatcattttggataaactctacaatcatcctgcagcatgtttagctacttttcgagaa
ttgtcgcagctagccaagcactacgtcatgaggacgttatttaccatacaagcaataccg
actagcactatttctgcttgggtaaacagtcaacaccaaaaagaacatcaagcagctctt
aatcagttgacggaaattcgtatttggcaaagtcacactttaccgggcgggatgcaaggc
atcaaattaaatgaatcatttcgagctaatttaaaaactgcgctttgcggaggcggtgaa
tcatggtatggaccacaactatcgaaagcagataaatatcagtttacatctgaagcattg
gatctaaaatcaaaagagcgatgggaatgcgtcctacattatttagttggtgccggtgag
gacttggctcttagtggcgaaattcaatcgttgcttaataactgtggcctggttagcaaa
aatggtattacggcggccggatttcaatttttgctgctagatagaccttctcaagtatgg
tacatcttattgcaatacttagattcagctgaatctcttgggatggatcttgttgaaatt
ttatcatttttgttccagttaagctactctacttttggtcagaattactcgacagaaggt
ttaacacaaactcagttgacatgtttgcaacatatgcgcgaaattggcttagttgtacaa
cgtaagaggaaagatatgaaattttatccaacgcaactagcaatcaatttggcttccggt
gcaaagcaagaggagctggatcattcaaaatcgtctggttacattattgttgaaacaaat
tatcgtctatatgcatacacagaatctcctcttgatattgccttggtggcgctattttgc
gaaatgatgtaccgactgcccggcctatgtgtgggcttaataaccagagaaagtgtacaa
caggcgtttacaaatggtatcacagctaataaaatcatcaattttattcgaacccacgct
catccagaagccaagaaaaaggtaactaccccaattgttccttcaacaattattgatcaa
ctatatctatgggaattggaacgtggtagattatcttgttctgatggagtgctttataat
cagatcttatcttcatctgatttcgaggcgctacgaaagtacgcagatgatatgggtgtt
ctattgtgggctagtcctgcaaagcggttactggtcgtgaatcgtgacggacataatcat
gttaagcacttctggaagcgtaataaacaaaaagattga

DBGET integrated database retrieval system