KEGG   Trichoplax adhaerens: TRIADDRAFT_20634Help
Entry
TRIADDRAFT_20634  CDS       T01069                                 

Definition
expressed hypothetical protein
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
tad  Trichoplax adhaerens
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    TRIADDRAFT_20634
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     TRIADDRAFT_20634
Peptidases [BR:tad01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   TRIADDRAFT_20634
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRIADDRAFT_20634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 242 aa AA seqDB search
MLADDYNRIVGGSEASKHEFPYQISLEQKYGKSWYHICGGSIIDSKWVLTAAHCVEGAKA
RKLRVNVGDHSIEDATEQIISLRRSIVHSAYDSNSLVNDIALLELSESATAKSNTATIPC
ASKATTMSDGDTVTVTGWGTLSSGGSSPDTLHKVNVNYFDDSKCLSAYGSEFSAKEMFCA
GVNGGGKDSCQGDSGGPAASGGRLVGVVSWGYGCADAQYPGVYTRVSNYQDWIEGYAGKI
IN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgacgactataacaggattgtcggtggaagtgaggctagcaaacatgaattt
ccttaccagatctcacttgagcaaaaatatggcaaaagttggtatcacatttgtggtgga
agtataattgacagcaaatgggttcttacagctgctcattgtgttgagggtgctaaagca
cgaaaattgagagtcaatgttggcgatcatagtattgaagatgctactgaacagattatt
tctttaagaagatcaattgtccattctgcctacgattctaatagcctcgtcaatgatatt
gccttgctcgagttgtctgaatcagctacagccaagagcaataccgctacaattccttgt
gcttcaaaagctacaaccatgtctgatggagatactgtcactgtaactggttggggtaca
ctttcatctggtggttcatctcccgatacattgcataaagtaaatgtgaattattttgat
gattccaaatgcttgagtgcatacggcagtgaattctctgctaaggaaatgttttgcgct
ggagtaaacggaggtggtaaagattcttgccaaggcgatagtggcggtccagccgcttct
ggcggaagattagttggtgttgtcagctggggctacggctgtgccgatgcacaatatcct
ggcgtttatacgcgtgtcagcaattatcaggattggatcgagggatatgccggcaaaata
atcaattaa

DBGET integrated database retrieval system