KEGG   Trichoplax adhaerens: TRIADDRAFT_20853Help
Entry
TRIADDRAFT_20853  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tad  Trichoplax adhaerens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tad00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 337 aa AA seqDB search
MLHSRFHHHVLRDWNSSNTDITPSNLIYPIFVSDDPECNEEITSLPEQRRFGVNKIDHVL
NDIVAQGLQSVIVFGILSRNESKDALGTNADSSLSPTIQAIKKLRELYPNLLIICDVCLC
PFTDHGHCGILDKDGYIKNEASIQRLAKIACSYAKAGCHVVAPSDMMDGRVNAIKESLIK
QGFGNRVSVLSYSAKFASCFYGPFRDAANSAPAFGDRRRYQLPMGSRSLALRAINRDIDE
GADIVMVKPGMPYLDIVRDTKDKHPDIPVAVYQVSGEYAMLYYASKEGAFTLQSVVMESL
RSMRRAGADIIITYFVPKVLAWLREPITGASPAEHEQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttacatagccgttttcaccatcatgtcttgcgggactggaattcatccaatactgat
attacaccgagtaatctaatttatccaatttttgttagtgatgatccagaatgcaacgaa
gagattacaagcttaccagagcagagaagatttggcgtcaataaaatagaccatgtctta
aatgacatagtggcacaaggattacaatctgtaatagttttcggtatcttgtcaaggaac
gaatccaaggatgctcttggcacaaatgctgattcctcactatctccaacgattcaggca
attaagaaattgcgggagttgtatcccaacctgttaattatatgcgatgtgtgcttgtgt
ccattcactgatcatggacactgcggaatactggataaagatgggtatatcaaaaacgaa
gcaagtattcaacgattagcaaaaattgcttgcagttacgccaaggccggatgtcatgta
gttgctccttcagatatgatggatgggagggttaatgctatcaaagaatcattaataaag
caaggctttggtaacagagtgtcggtcttaagttacagtgcaaaattcgcatcttgcttc
tatgggccatttcgggatgctgcaaattcagcacctgccttcggggacagacgtagatat
cagctccctatgggttcgagaagtctagcattaagggcgattaaccgtgatattgatgaa
ggagccgatattgtgatggtgaaacctggcatgccgtacttggatattgtaagagatacg
aaagataagcatccagatatccccgtagccgtttatcaggtttccggagaatatgccatg
ctatattacgctagtaaagaaggtgcttttactttacaatcagttgttatggaatcttta
aggagcatgcgccgagcaggtgcagatattattatcacatattttgtaccaaaggttctt
gcctggcttcgggaacctataacgggtgcaagtcctgccgaacatgaacaataa

DBGET integrated database retrieval system