KEGG   Trichoplax adhaerens: TRIADDRAFT_20853Help
Entry
TRIADDRAFT_20853  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tad  Trichoplax adhaerens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TRIADDRAFT_20853
Enzymes [BR:tad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TRIADDRAFT_20853
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRIADDRAFT_20853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 337 aa AA seqDB search
MLHSRFHHHVLRDWNSSNTDITPSNLIYPIFVSDDPECNEEITSLPEQRRFGVNKIDHVL
NDIVAQGLQSVIVFGILSRNESKDALGTNADSSLSPTIQAIKKLRELYPNLLIICDVCLC
PFTDHGHCGILDKDGYIKNEASIQRLAKIACSYAKAGCHVVAPSDMMDGRVNAIKESLIK
QGFGNRVSVLSYSAKFASCFYGPFRDAANSAPAFGDRRRYQLPMGSRSLALRAINRDIDE
GADIVMVKPGMPYLDIVRDTKDKHPDIPVAVYQVSGEYAMLYYASKEGAFTLQSVVMESL
RSMRRAGADIIITYFVPKVLAWLREPITGASPAEHEQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttacatagccgttttcaccatcatgtcttgcgggactggaattcatccaatactgat
attacaccgagtaatctaatttatccaatttttgttagtgatgatccagaatgcaacgaa
gagattacaagcttaccagagcagagaagatttggcgtcaataaaatagaccatgtctta
aatgacatagtggcacaaggattacaatctgtaatagttttcggtatcttgtcaaggaac
gaatccaaggatgctcttggcacaaatgctgattcctcactatctccaacgattcaggca
attaagaaattgcgggagttgtatcccaacctgttaattatatgcgatgtgtgcttgtgt
ccattcactgatcatggacactgcggaatactggataaagatgggtatatcaaaaacgaa
gcaagtattcaacgattagcaaaaattgcttgcagttacgccaaggccggatgtcatgta
gttgctccttcagatatgatggatgggagggttaatgctatcaaagaatcattaataaag
caaggctttggtaacagagtgtcggtcttaagttacagtgcaaaattcgcatcttgcttc
tatgggccatttcgggatgctgcaaattcagcacctgccttcggggacagacgtagatat
cagctccctatgggttcgagaagtctagcattaagggcgattaaccgtgatattgatgaa
ggagccgatattgtgatggtgaaacctggcatgccgtacttggatattgtaagagatacg
aaagataagcatccagatatccccgtagccgtttatcaggtttccggagaatatgccatg
ctatattacgctagtaaagaaggtgcttttactttacaatcagttgttatggaatcttta
aggagcatgcgccgagcaggtgcagatattattatcacatattttgtaccaaaggttctt
gcctggcttcgggaacctataacgggtgcaagtcctgccgaacatgaacaataa

DBGET integrated database retrieval system