KEGG   Trichoplax adhaerens: TRIADDRAFT_20860Help
Entry
TRIADDRAFT_20860  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 404 aa AA seqDB search
MAAQIRQRSADVIKYINRYSQYTPLSLSIKQLMDFGRHGSILNSYKFLSSELPIRLAHIM
KELRYLPVGLLDMPSVQRVDNWYATSLIELIDFRDQHKGKSCEVTAKNFTNLVANIRQRH
NSVVETMAQGIIELKLAKKDYNLDQHRLQYFLDRFYTNRMSIRLLITQHNMLFGEENAEK
KHIGCIDPSCNLSEIVASAVNNASELCDQYYMVVPPVDINEANAVEPGSGVDICYIPSHL
HYMVFELLKNSMRAVVENHQNNLNLPPIQVTITKGEEDILIRICDRGGGIPISKLEDIYS
YMYSTAPQPPSLDLVARSETVTPLAGFGVGLPLSRLYARYLNGDLKLSPLEGYGMDAYIY
LKRFSVKANEVLPVFGEAASQQYRVRGLSGDWTASASNRKDKSG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcaaattcgtcaacgaagcgctgatgtcattaaatacatcaatcgctacagt
cagtatacaccgttgtcgctttccattaaacaactgatggattttggtcgtcatggctca
atccttaattcatataagttcttgagttccgaactccctataaggttggcgcatattatg
aaggaattgcgttatttgcctgttggattattagatatgccgtcggtgcaaagagttgat
aattggtacgcaactagtttaatcgagttaatcgattttagagaccagcacaaaggtaaa
tcctgtgaagtgactgctaagaattttacgaatttggtagcaaacatcagacagcgccat
aatagcgtagtagaaacaatggcgcagggcattatagaattgaagcttgctaagaaagac
tataatttagatcaacatcgtttacaatattttttagatcgcttctataccaacagaatg
agtattagattattaattacgcaacacaacatgctattcggtgaagagaatgcagaaaaa
aagcatattggctgcattgatccgtcttgtaatttatcagaaattgttgcaagtgcagtt
aataatgctagcgaattatgcgatcaatattatatggttgttccaccagttgatattaac
gaagctaacgccgtagaacctggtagtggtgttgatatatgttacattccatctcatttg
cattacatggtgtttgaactattaaagaattctatgagagcagtagttgaaaatcatcaa
aataatctcaacttacctccaattcaagttactatcaccaaaggcgaagaagacattctt
attaggatctgtgatagaggagggggtatcccaatctcaaaattagaagacatttacagt
tacatgtactcaaccgcacctcaaccgccatcactggatttggttgcaaggtcagaaaca
gtaacgccgcttgctggctttggtgttggcctgccattatctcgcttgtatgctaggtat
ttaaacggagatttaaagctttcccccttggagggttatggtatggatgcatatatttat
ctaaagcgattttctgtgaaagccaatgaagttctaccggtatttggcgaagcagcatct
cagcaatatcgtgttagaggattgagtggagactggaccgcatcagcgagtaatcgcaaa
gacaaaagtggataa

DBGET integrated database retrieval system