KEGG   Trichoplax adhaerens: TRIADDRAFT_20947Help
Entry
TRIADDRAFT_20947  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tad  Trichoplax adhaerens
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRIADDRAFT_20947
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     TRIADDRAFT_20947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 348 aa AA seqDB search
PPEYRYVIFVNPKSGTGKSRKIFKNAPKRMLREAEAEYTLITTERQGHAYDYVKEMKLNQ
VDGIIIVSGDGLIHEVINGLMSREDWEHAIKLPIGALPGGSGNALYQSILYESNITSAMF
MIIKRYTTKLDLVSITTLKDQRYSFLSVGWGLLSDVDIGTEKFRKLGTARFVLGTVKHLT
KLKYYHGKFQYLPNPMKATAGATNNTESKAGPKSILPPINESLPSTWETVEDDMVLFGAI
YLPYLSTDNFVAPTSRLNDGIIHLQTIDSTCNRKTMLKILSKQKEAGHLGMSCVEVFPCK
AFRLEPITSPGIITVDGECVDYGTIQGEIFPGLSRVFCRRAKSSSSSS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ccaccagagtaccgttacgttattttcgtgaatcctaaaagtggtacaggaaagtcacgt
aagatctttaaaaatgcccctaagaggatgttaagagaagctgaagccgaatacacttta
atcacaacagaaaggcaaggtcatgcttatgattatgtaaaggaaatgaaattaaatcaa
gtcgatgggatcattattgtctctggtgatgggttaatccatgaagttattaatggatta
atgagcagggaagactgggagcatgcaattaagctaccgatcggtgcattacctggtgga
tcaggaaatgccttataccaatcgattttatatgaatccaatataacaagcgccatgttt
atgataatcaagagatatactactaaattggatttagtctccattacaacactcaaagat
caacgatactcttttctatcagttggatggggtttactttccgatgttgacataggtact
gaaaaatttagaaaattgggcacggcaagattcgttttaggcacagtaaagcatttaacg
aaattaaaatattatcatggtaaatttcaatatctacctaatccaatgaaagctaccgcg
ggagcaaccaataatactgagtctaaggcaggcccgaaatcgatattgccaccaataaat
gaatctttgccttctacttgggaaacagtcgaagatgatatggttctgtttggtgcaatc
tacttgccatatttatcaacagacaactttgttgctcccacatctcggctaaacgatggc
attatacacttacaaactatcgattcaacttgcaacagaaaaaccatgctaaagatatta
tctaaacagaaagaagcaggccatctaggcatgagctgcgtggaggtatttccttgcaaa
gcctttcgtttagaaccgataactagccctggaattattactgtagatggtgaatgcgtg
gattatggtacgattcagggagaaatctttcccggtttaagtcgagtattctgtcgtagg
gctaagtctagtagcagtagtagttag

DBGET integrated database retrieval system