KEGG   Trichoplax adhaerens: TRIADDRAFT_21026Help
Entry
TRIADDRAFT_21026  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
tad  Trichoplax adhaerens
Module
MAPK (p38) signaling
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     TRIADDRAFT_21026
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   TRIADDRAFT_21026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 268 aa AA seqDB search
FDCDATDLQIISELGRGAFGVVHKVCHRPSGVIMAVKRIRANVSSKDQKYLLQDLDVSMA
SDSPYTVKVYGALFKEGDVWICMESMEESFDKFYVKVFKQSKRFNEAILCYFANCVIKAL
SYLHNKLKVIHRDVKPSNILLDLNGLVKLCDFGISGQLVNSIAKTREAGCKPYMAPERIN
PTNTGGGYDIRSDVWSFGITMLEISTGKFPYAKWRTPFEQLKQVVMDDPPRLPDDGNFST
EYRDFIGQCLQKDVHKRLKYDKLLVGFA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
tttgattgcgatgccaccgatttacaaattataagtgagcttggccgtggagcatttggt
gttgtccacaaagtttgtcatcgtcccagtggagtcattatggcagttaagagaatccga
gcaaatgtcagttcgaaagatcagaaatatttattgcaagacttggatgtttcgatggca
agtgacagtccttacacagttaaagtttatggtgcattatttaaagagggtgatgtttgg
atttgcatggaatccatggaggaatctttcgataaattttatgtcaaagtattcaaacag
tccaaaagatttaatgaagcaatattatgctactttgcgaattgtgtcattaaagctctt
tcttacttacataacaaattaaaagtaattcatagagatgtcaagccatcaaatatttta
ttggacctaaatggccttgtaaagttatgcgattttgggatcagtggtcaattagtcaat
tccatagccaaaaccagagaggctggatgtaaaccatatatggctcctgaaagaattaac
ccaactaataccggcggtggttatgatattagatcggatgtgtggagttttggaattact
atgctggagatatcaaccggtaaatttccttatgccaaatggcgtacaccttttgaacag
ctcaaacaggtggtcatggatgatccacctcgcctaccggacgatgggaatttctcaact
gaatatcgagattttattggtcaatgtttacaaaaggacgttcacaaaagattgaaatat
gacaaactactggtaggctttgcatga

DBGET integrated database retrieval system