KEGG   Trichoplax adhaerens: TRIADDRAFT_21042Help
Entry
TRIADDRAFT_21042  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tad  Trichoplax adhaerens
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tad04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1262 aa AA seqDB search
MEEDEGNELRDFNVPIFFNQPRHTEDVRGLKMLEKSWKMTERMKTVSVALVLCLNVGVDP
PDLIKPTPCARLECWLDPLTMNPNKSLEAVGNSLQKQYERWQPKARYKQSLDPTVEEVKK
LCLSLRRNAKDDRVLFHYNGHGVPRPTQNGEIWVFNKNYTQYIPLSIYDLQSWIAGPTVF
TYDCSNAGAIIDHYLLFCQQRREESPVSVKNIIGPLTNLPFFTLLDNCIHMASCSSNEVL
PLNPDLPADLFTSCLTTPIKTALRWFCINNNNLLVPNITLEMIEKIPGKLNDRRTLIGEL
NWIFTAVTDTIAWNVLPTKIFQKLFRQDLLVASLFRNFLLAERIMRSFNCSPTSHPKLPS
THSHPMWYTWDLVLDRCLSQLPSIINNGEEFAHSTFFEDQLTAFQVWLALGSKERNVPEQ
LPVVLQVLLSQIHRIRALDLLGKFLDFGVWAVELALSVGIFPYVLRLLQSSARELKPRML
FIWTKILAHDISCQVDLVKDGAYKYFLQILADSQMPSKDRAMAAYIIAMVIKDYPTGKEA
AQQSNIIAICTELLDDPNPLLRQWVVLCLGYEWNGYDPARWCAVRDNAYEKLSHLLADEC
VEVRASVVYALGTFVSNKNDRNGQADNIDQGIGMTLAACVRDGSPVVRKELVVALSGFVL
EFESYFISTATKLVREVESEKDKNRNNQSGPGAPGGRVLVPNKNTGLTLHQSTDSSHSQQ
SRRSRLFMSQSNNSLSPATTGDYHPALERLLSLPPRSVYNMVWRALITLLNDPFPEISDL
GKELCNYLMIKITAGSSSPTGSLRVSESVSTDIGGLDDSALHAKKFSKYVILNNFSLDCW
GIERSQSQPQMPITDILPHSQQFSNKRTVFGRGPSNSDSSDDDTDNKIYRLPNVKTELGS
WCSSQFRKSLLKPLNYYDPSSQEYYESEWKYLFNAEIRAEAAASYRYLSKCKSQLDDECF
IQRSTFPPQIMTFMEYQKAIIVAGQNEINVWNWEQSNKMKSFRNSLKNYKITALEVINEH
HSPLLLAGTDDGSLRLWKHFDNDDNNLKLVTAWKGLSEMLRSSFRRSGLVMSWEQQSGKL
LCSGDVKSVSIWDVRRETKVQEIPTGAGSCVTSISSGVADRSSLLVVGCGDGSVRLFDRR
LPANESRVKTLFEHKAWVVKVHRQSGGNGNIISGSIAGDVKFWDPRFTESVKTIDTQHTL
NAMDVHKEADILVCGSTSQVIHVYNHSGELNSAIKYHDGFRVQKIGPISCLAFHPYKVCK
LI
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagatgaaggcaatgaactacgcgattttaacgtacccatatttttcaatcag
ccacggcatactgaagatgtccgaggtttaaaaatgctggagaaatcttggaagatgact
gagaggatgaaaactgtaagtgtagcattagtattatgcttgaatgttggtgttgatcct
cccgatcttatcaagcctactccttgtgcacgactagaatgttggctagatcccctaacg
atgaatcctaataaatcgcttgaagctgtcggtaatagtttacagaaacagtatgaaaga
tggcagcccaaggcacgctataagcagagtttggatcctacggtagaggaagtcaaaaaa
ttgtgtctctccttgcggcgcaatgctaaggatgatagggtactgtttcattataatggg
catggagtacctcgacctactcaaaatggtgaaatatgggttttcaataagaactacacg
cagtatattccattatcgatatatgatctgcaaagttggattgctggtcctactgttttt
acttatgattgttctaatgccggtgctattattgaccattacttacttttttgtcagcaa
cgacgtgaggaaagtcctgtaagtgtaaaaaatattattggtccattaactaatcttcct
ttctttactttattagataattgtattcacatggcttcctgtagctccaatgaagtatta
ccgttaaatccagatttaccagctgatttatttacatcatgccttacaactccaattaaa
acagccctaagatggttttgcataaataataacaaccttttggtacctaatataacttta
gaaatgatcgaaaaaattccaggaaaattgaacgaccgaagaacactgattggagaacta
aactggatatttactgctgtaactgatacgatcgcttggaatgttcttcctactaaaata
tttcagaagttatttcgccaagatctgctagttgcaagtctatttcgaaattttcttttg
gctgaaaggataatgcgttcttttaattgttcaccgacgtcacatccgaaattaccaagt
actcacagtcacccaatgtggtatacatgggatttagtccttgatcgatgtctatctcaa
ttaccatctattatcaataatggagaagaatttgcgcatagcacattctttgaggatcaa
cttacagcattccaagtgtggttagcgttaggatcgaaagaacgcaatgttcctgagcaa
ttaccggttgttctacaggttttgttgagtcaaattcacagaattcgagctcttgacttg
ttaggaaagtttctcgatttcggcgtatgggctgtagaactggccctttcggttggcatt
ttcccgtatgtgttgcgacttcttcaaagttctgctagagaactaaaaccgcggatgtta
tttatttggacaaagattttagctcacgatattagttgccaggttgatttagtaaaggac
ggtgcttataaatactttctccaaattctggcagattctcaaatgccgtcaaaggataga
gctatggctgcttatataatagctatggtaattaaagattatcctacaggaaaggaggca
gctcaacaaagcaatattattgctatatgcaccgagttgctagatgacccaaacccttta
ttgcgtcagtgggtagtactatgtttaggatatgaatggaatgggtatgatccggctaga
tggtgtgccgttagagataacgcgtacgagaagttatctcatttacttgccgatgaatgt
gttgaggttagagcaagtgttgtgtatgcattgggtacattcgtaagtaataaaaacgat
cgtaatggccaagctgataacattgatcaaggaattggaatgacattggcagcatgtgta
agggatggcagtccggtagtgcgaaaggaacttgttgttgcattatctggatttgtattg
gaatttgaatcatatttcatatccacagctacgaaattggtaagagaagttgagagtgag
aaagataaaaaccgtaacaaccaaagtggccctggagcacctggtggacgggttttggtt
ccaaataaaaatactggtctgacgctgcatcagagtactgacagctcccattctcagcaa
tcacgtcgatctcgtttatttatgagtcagtcaaataattctttatcgccagctacaact
ggtgattaccatcccgcgctcgagcgtttgttgtcacttccacctagaagtgtatataat
atggtttggagggctttgattacgttgcttaatgatccttttccggaaattagcgatcta
ggaaaggaactttgtaactaccttatgatcaagattactgctggtagctcaagcccaact
ggtagcttacgggtaagcgaatcagtttctacagatattggtggattggatgatagtgca
ctacacgctaaaaaattcagcaagtacgttattctaaataatttctcattagactgttgg
ggtatagaacgtagtcaatcacaaccgcaaatgccaataactgatatactacctcattct
cagcaattctcaaacaaaagaacagtttttggtcgaggcccatcgaattcagatagtagt
gatgatgataccgacaataagatatatagattgcctaatgtaaaaacagagttgggatcc
tggtgttcaagccagtttcgaaagtctttattaaagcctctaaattattatgatccgtcg
agtcaagagtattatgaaagtgagtggaaatatttatttaatgctgagattagagcagaa
gctgcagcatcttaccgatatttaagtaagtgtaaatctcaattggatgatgagtgtttt
attcaaagaagtactttcccacctcaaataatgacatttatggaatatcagaaggccatc
atcgtggctggacaaaacgaaattaacgtttggaactgggagcagtcgaataaaatgaaa
tcgttcaggaatagcttaaaaaattataaaataactgccttggaagttattaatgagcat
cactcaccgttgctattagctggaacagatgacggtagcttacggctatggaagcatttc
gataatgatgacaacaatttgaagttagtaactgcttggaaaggattgagtgaaatgcta
agatcctcctttagaaggtcaggtttagtaatgagctgggagcagcaatcaggtaaatta
ttatgtagcggtgacgttaaatctgttagtatatgggacgttagaagagagacgaaagta
caggaaataccgactggagcgggcagttgtgttacaagtatttccagtggagttgctgat
agatcatcgctactagtggttggttgtggtgacggctcagtaaggttatttgatcgaagg
ctacctgcaaatgagagccgcgttaaaacgttatttgaacacaaggcttgggttgtgaaa
gttcacagacaaagtggaggaaatggtaacatcattagtggcagtattgctggtgacgtg
aaattttgggatccgcgtttcactgaatctgttaaaacgattgatactcagcatacatta
aatgctatggacgtacataaggaagccgatattctcgtttgcggctcaactagccaagtg
atacatgtttacaatcacagcggtgaattaaatagtgcaatcaaatatcatgatggattt
agagtgcaaaaaattggacccattagctgcttagcatttcatccctataaggtttgtaaa
ctaatttaa

DBGET integrated database retrieval system