KEGG   Trichoplax adhaerens: TRIADDRAFT_21281Help
Entry
TRIADDRAFT_21281  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
tad  Trichoplax adhaerens
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tad04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 320 aa AA seqDB search
LDQQLEEIKKETGLLTIDGKKYKIGLDDLQVMGQIGSGTCGTVYAMEHAATRSVIAVKKI
PRIQNEEEKKRVLMDLQVVMKSHDCPYIVKCFGLLIAESDILICMEKMSTCLCKLLTRTG
QPIPEDILGKITVAVVKALHYLKQNHGVIHRDVKPSNILLDADGNVKLCDFGISGRLVDS
KARTRGKGCAAYMSPERIDPSNPTGTYDIRADVWSLGISLVELATGKFPYDECEGEFQVL
TRILQDDPPKLPSNGQFSQEFCSFVEKCLIKDHDRRPKYAELLQHKFIQIYETKDVDVAS
WFNQLIEETSGDCGVNLFDV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggatcagcagctagaagagattaagaaggaaactggtttactaactattgatggaaag
aaatataaaataggccttgacgatcttcaagttatgggtcaaattggcagtggaacttgc
gggactgtctatgccatggaacatgcagcaactagatctgtaatagcagttaagaaaatt
cctcgaattcaaaatgaagaagagaaaaaacgagtattaatggatttacaagtagttatg
aagagtcatgattgtccatacatagttaaatgcttcggcttactgattgcagagtctgat
attttgatctgcatggagaaaatgagtacatgtttatgcaaactgctaactagaaccggt
cagcctattcctgaagatatcttaggaaagatcacagtcgcggttgtcaaggcactacac
tacctgaaacaaaatcatggagtaattcatcgagatgtcaagccatcaaatattctatta
gatgctgatggtaatgttaaattgtgcgattttggtattagtgggcgtttagttgattct
aaagctcgtacacgtggcaaaggatgtgcagcatacatgtcgcctgaaagaattgatccg
tcaaatcctactggaacatatgatattcgcgcagacgtttggagtttaggaatttctctg
gttgaactggcgaccggaaaatttccttacgatgaatgtgaaggagaatttcaagtgttg
acgagaatattgcaagatgatccacctaaactaccaagcaatggtcaattttcacaagaa
ttttgctcatttgtagagaaatgtttaataaaagatcacgatcgcaggccgaaatatgcc
gaattactacaacataaattcatccaaatttacgaaacgaaagatgttgatgttgcatct
tggtttaaccaactgattgaagagacatctggagactgtggtgttaacctattcgatgta
taa

DBGET integrated database retrieval system