KEGG   Trichoplax adhaerens: TRIADDRAFT_21658Help
Entry
TRIADDRAFT_21658  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    TRIADDRAFT_21658
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TRIADDRAFT_21658
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRIADDRAFT_21658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1039 aa AA seqDB search
LKANASQGAAKIQFVVRNFSKIDSTVLSEPVHARNIPWRIMLMPRHSGQDKTKHIGFFLQ
CAPETDSLSWTCSASAILMLVNQSNKEASIIRKIHHVFFPKENDWGFSQFISWNDTMDPS
KGFIKNDTIILEASLNADPPHGVCWDSKKITGFVGLRNQGATCYMNSLLQTLFFTTQLRR
AVYMMPTENDDPVRSVPLAMQRIFYDLQYSDKPVGTKKLTRSFGWETLDSFMQHDVQELS
RVLLDNLENKMKGTCVEGTIPKQLEGKMISYIKCLHVDYMSSRIEPFLDIQINVKGKKTI
YESFDDYIRFETMDGENKYDAGEYGLQEARKGVMFSNFPPILHLQLMRFQYDPLADLNVK
INDRYEFYDKLDLNKFLEKPESEPANYTLHAVLVHSGDNHGGHYVVYINVKGDGKWFKFD
DDVVSQATAEEAIDNNYGGTEGDEHFGRHCTNAYMLVYIRDSCLDEVLRELNDDDIPESL
KRRFAEEKKLEVQRRKERNEAHLYMSVQVWREDQFSCHQGFDLFVADKAKHSTYKALKKS
TLTEFLTALADSIGYSVAEMRPWPLFHRPNGTTRVIGLDEADYDRTLFDLADNDENWFIF
LETLLPDSGLKSLPPYDKNSQVIVFLKYYDVMNRKTSYVGHLYIELSMSLDDIAKKCREF
VSIPSSVPLLFFEEVKPNRVDILTDTSIPLLKVMGDFTDGDILCFQIDSKDEKIPTVEDY
FRELFNRIDVKFFDKNVSNDPGFTLTLSQRMHYIEIANAVASHLSIDPMMLQFFKSYQPY
RDAASHHPIRCSFEGTLMDLFLHYKPSMAKKLYYQKLTIPVTEMENRVQVKCTWVTKHLK
EETEFFVHPYKDATIEELLDEARTLIKLPSGGTGKLRLLEVVSNKICTCYDEESSIDCLT
QPLQRSYRLEEIPHDQMDLEDNEILIQVAHFQKEIFQTFGVPFLMKIVDGESIDSIKRKI
KERLDISDKDFEKYKVAIVRLGRVTYLPDDEDKTISIEDLQPTHGGSFVGRPWLGLDHVN
KQPKKTRYSYMERAIKILN
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccaacgctagccaaggtgcagcaaagatacaatttgttgtacgcaacttttcc
aaaattgatagcactgtacttagtgaaccagtacatgctaggaatattccatggcgcatt
atgttaatgccacgacattctggtcaggacaaaactaagcatataggattctttttacaa
tgtgcacctgagaccgacagtttgtcttggacgtgcagtgcgtcggcaatattaatgcta
gtgaatcaatccaataaagaggcgtccataattagaaagattcatcatgtattttttcca
aaagaaaatgattggggttttagtcagtttatttcatggaatgatacgatggatccaagt
aagggatttattaagaatgataccattattttagaggcttccttaaatgcagatcctcca
catggtgtctgttgggattcgaagaaaattactggttttgttggattaagaaatcaagga
gctacatgttatatgaattcactattacaaactttattctttactacgcaattgagaagg
gctgtttatatgatgccaaccgaaaatgatgatcctgttagaagtgttcctttagctatg
cagagaatattttatgatttacaatatagcgataagcctgttggaactaaaaagcttact
agatctttcggttgggaaactttagattctttcatgcagcacgatgtgcaagagctatct
agagtgttgttagataacttggagaataaaatgaagggtacatgtgttgagggaacaatt
ccgaagcagttggaaggaaaaatgatctcttacataaagtgcctacatgtagattatatg
tcatccagaatagagccgttcttagatattcagattaacgtgaaaggaaagaaaactatt
tatgaatcatttgacgactatatacgttttgaaaccatggatggagaaaataagtatgat
gctggtgaatacggactgcaggaagctcgcaagggtgtaatgttctcgaattttcccccc
atattacacttgcagttaatgcgatttcaatacgacccccttgctgatcttaatgttaaa
ataaatgacagatacgaattctatgacaaactggaccttaataaattcctagaaaaacct
gagagtgagcctgcaaattataccctacatgctgtattagttcattcaggagacaatcat
ggtggtcattatgttgtttatattaatgtgaaaggagacggaaagtggtttaaatttgat
gacgacgtcgtttctcaggcaactgctgaagaagctatcgacaacaactatggtggaact
gaaggagatgaacatttcgggagacattgtacaaacgcttatatgcttgtatatataagg
gatagttgtctagatgaagtcttacgtgaattaaatgacgatgatattcctgaaagtttg
aagagacggtttgcggaagagaaaaaactagaagttcagagaaggaaagaaagaaacgaa
gctcatttatatatgtcagtacaggtttggagagaggaccagttttcttgtcaccaggga
tttgatttatttgttgcagataaggcaaaacacagtacctacaaagcattaaagaaatca
actttaactgaatttttaacggcacttgctgattcaattggttattctgtagctgagatg
agaccgtggcccctgtttcatagacccaatggtacgacacgtgttattggattagacgaa
gctgactatgacagaacgctttttgatttagcggacaatgacgaaaattggtttattttc
ctagagacgctcttgccagattctggactaaagagtttaccgccttatgataaaaatagt
caagtcattgtttttttgaagtattatgacgtaatgaatagaaaaacttcatatgttggc
catttgtacatagaattatccatgtcattggatgatatagctaagaaatgtcgcgaattt
gtaagtattccgtctagcgttcctctcctatttttcgaggaagtaaagccaaatagagtt
gacatactcaccgatacaagtatacctctcttgaaggtgatgggagacttcacagatgga
gatatactttgttttcaaatcgactctaaagatgaaaaaattcctacggtagaagattac
ttcagggaactctttaatcgtattgatgtaaaattctttgataaaaacgtttcaaatgat
cctggtttcacattaactttatctcaacgaatgcactatatagagattgcaaatgcagtt
gcatcacatttaagtatcgatccgatgatgttgcagttctttaaaagttatcaaccatat
cgagatgcagcaagtcatcatcctattcggtgttcattcgagggaaccctaatggacttg
tttttacactacaaaccgtcaatggcaaaaaagctttattaccaaaagcttactatcccg
gttaccgaaatggaaaatcgagtacaagtaaaatgtacttgggtaacgaaacatttgaag
gaggagaccgaattttttgtccatccatataaagatgctactattgaagagctattagat
gaagcaaggacactgattaagttaccctcgggaggcactgggaagctcagactgctagaa
gtggttagcaacaaaatttgtacttgctatgatgaagaaagtagcatcgattgtcttact
cagcctttgcaacgtagttacagactcgaggaaataccacatgatcaaatggacttagaa
gataatgaaattctcatccaagttgcacattttcagaaggaaatttttcaaacttttggt
gtaccgttcttaatgaaaattgttgacggagaatcaatagattctatcaagcgaaaaatt
aaggagagattagatatatctgacaaagatttcgaaaagtataaagttgccatcgtaaga
cttggtcgtgttacgtacctgccagatgatgaggataaaacaatttctattgaagatttg
caaccaacacatggtggtagttttgttggccggccgtggcttggcttagatcacgtaaac
aaacagcctaagaagactcgttactcttatatggaaagagcaataaagattttaaattaa

DBGET integrated database retrieval system