KEGG   Trichoplax adhaerens: TRIADDRAFT_21661Help
Entry
TRIADDRAFT_21661  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIADDRAFT_21661
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C86
   TRIADDRAFT_21661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 193 aa AA seqDB search
MSSNPKADENNKKIERSPYHERQRQGLCALHTLNCTFQDGAFTKKDLDNICFELSGKKWF
NPHKNYSGFYDVNVIISALRKKSYSLIWFDRRKKISSINFSNVFSFVVNISTNFKLCWLV
LKSYWSHWFSIRQIGDNYYNLDSKLTRPQQVQNITDFLQPYSINPNCHIFLVVSEDVEKE
KSWLIDDESTTSD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcaatccaaaagcagatgagaacaacaaaaaaattgaacgttcaccttatcat
gaacgccagagacaaggtctatgtgcgttacatacgctaaattgtacttttcaagatggt
gcatttaccaaaaaagatctcgataatatttgtttcgaattatctggcaaaaaatggttc
aatccacataaaaattatagcgggttctatgatgtcaacgttattatttcagccttacga
aaaaagtcctattccttgatttggttcgacagaagaaagaaaatatcaagcataaatttt
agcaacgtcttctcatttgttgtcaatatttcaactaatttcaaactatgttggttggta
ttaaaatcttattggagccattggtttagtatccgtcaaattggtgataattactacaat
ctggattcgaaattaactcgtccacagcaagtacaaaatattacagatttcttgcaacca
tattccattaacccaaattgtcatatatttcttgtggtttctgaggatgtagaaaaggag
aaatcgtggctaattgatgatgaatcgactacctcagattaa

DBGET integrated database retrieval system