KEGG   Trichoplax adhaerens: TRIADDRAFT_21889Help
Entry
TRIADDRAFT_21889  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tad  Trichoplax adhaerens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRIADDRAFT_21889
Translation factors [BR:tad03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TRIADDRAFT_21889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 694 aa AA seqDB search
MEKDTTDKSNQEENDEDLIDESEIDDAQFEDPPDFVDNLTDRDVAAEGGFICPIANDDLS
SLLVVDNVPEVGQEKLEKLKNVITRIFGRFGNVTSNYFPQGSNGKTKGYIFLEFATKEEA
VSACRATNGYALDKQHIFAVNLFNDFEKYRSPPSQEKIEPNPFVEEENLRWWLQDPDCAD
QYAMQFGHYTGIYWNSTRSPTLIIEREHWTESAAVKWTPKGTYLATCHDKGIILWGGKGF
DRKMRFTHRNVKHIDFSPCERYLVSFSPEFLEQKEGDDQTPIIIWDVRTGKKKRGFYCEP
DAIRWPVLKWSHDGKYFARITKAGQEDACISVYDTETCGLLDKKSIKIPCVKDFSWSPGD
HVLAFWVPEVKDIPARVTLMQIPTRNEIRSKNLFSVADCKMFWQSKGDYLCVQVSRMNKN
KKISFCNFEIFHVRQKLIPVDNIELRDTVVDCGIEPGGSKLVVIHGEGVRSSASFYELHD
AKGQLSCLKTIEKVQVNTVSWSPNGRFVVLAQLRTSSDGVLEFYDSTDITLMGTGEHFKV
TDINWDPTGRYIITGVSSWAVKMDAGYTAWSFQGKCLRQEQIDNFGIISWRPRPPTLLSA
EEISRIKKDLKKYQRTFDAKDRMSQSKASKELVDKRRKLVQDYTTYREQKTKVYEREAVQ
RRSLRYEEEEKNTEDDYVEEVIEVLVKEELFPIE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagataccacggacaaatcaaatcaagaagagaacgacgaagatttaattgat
gagagcgaaatagatgatgctcaatttgaagatccaccggactttgtcgacaatttaact
gatagagacgtcgcagcagaaggcggttttatctgcccaattgccaatgatgacctcagc
agtttactggtggttgacaatgtacccgaagttggtcaggagaaattagaaaaactaaaa
aatgtcatcacacgaattttcggtcgatttggaaatgtaacctccaattactttcctcaa
ggtagcaatggcaaaactaaaggatatattttcctggaattcgctaccaaagaagaagct
gtcagcgcttgcagagcaaccaatggttatgcacttgataagcagcacatttttgctgtc
aatctatttaatgattttgaaaagtatcgttctcctccttcacaggaaaaaatcgagcct
aatccatttgttgaagaggagaatttacgttggtggttacaagatcctgactgtgctgac
cagtatgctatgcagtttggccactacactggcatttactggaatagtactcgcagtcct
acgctaataattgaacgagagcactggactgaatctgctgcagttaaatggactccaaaa
ggtacttaccttgcaacatgtcacgataaggggatcattttatggggtggtaaaggattc
gacagaaaaatgagatttacccatcgaaatgtcaagcatatcgatttctcaccatgcgaa
agatatcttgtttcattcagtccagaatttttggagcaaaaggaaggcgatgatcaaacg
ccaatcattatttgggatgttcgcactggaaaaaagaaacgtggattttattgtgaacct
gatgcaatccgatggcctgtcttaaagtggagtcatgatggaaagtattttgctcgaata
acaaaagctgggcaagaagatgcttgtattagtgtctatgatacagagacgtgtggactg
ctagataagaagagtatcaagataccatgtgtaaaggacttttcctggtctcctggtgat
catgtcttggctttctgggttccagaagttaaagatatccctgctcgagtaacgttaatg
caaattccaacgcgaaatgaaattcgatcgaaaaatctctttagtgtcgctgactgtaaa
atgttttggcaaagtaaaggggattacctttgtgttcaagtgagcagaatgaataaaaac
aagaagatttcattctgcaactttgaaatctttcatgtcagacaaaagctaatcccggta
gataatattgaattgcgagataccgttgtcgattgtggaatcgaacctggtggctcaaaa
ttagttgttattcatggagagggtgtacgcagctctgcatcattttacgaattgcatgat
gctaaaggacaactatcttgtctaaaaaccatagaaaaagtacaagtaaatactgtgtct
tggtcacctaatggcagatttgtggttttggcccaattacgaacatcttccgatggtgtg
ctagaattttatgatagtaccgatataacgcttatgggtaccggtgaacactttaaagtc
actgatatcaattgggatcctacaggaagatatattattactggagtgagtagctgggct
gttaagatggatgcaggttatactgcgtggtcattccaaggaaaatgtttgcgccaagaa
caaatagataactttggaatcatttcatggcgtcctcgacctccaactcttctcagcgcc
gaggaaatttcacgtattaaaaaggatttgaaaaaatatcaacgtaccttcgatgccaaa
gatcgtatgagtcaaagtaaagcgtcaaaggaactcgttgataagaggcgaaagcttgta
caagattacacaacttatcgtgaacaaaagacgaaggtatacgaaagggaagctgtacaa
cgaaggtcccttcgttatgaagaagaagaaaagaatactgaagatgattatgtcgaggaa
gtcatagaggtcttagtcaaagaagagctcttcccgatagaataa

DBGET integrated database retrieval system