KEGG   Trichoplax adhaerens: TRIADDRAFT_21924Help
Entry
TRIADDRAFT_21924  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tad  Trichoplax adhaerens
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TRIADDRAFT_21924
Protein phosphatases and associated proteins [BR:tad01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TRIADDRAFT_21924
Ubiquitin system [BR:tad04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     TRIADDRAFT_21924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 360 aa AA seqDB search
MTLLYDIAKAYMALCSFKCKQSIKFFNSLSYHHYNTSWILCQVGKAFYESCQFRKAAAVF
ANVRKLDPYKVEDMDIYSTTLWHLHKESDLAYLTHEMIDISRQCPQTWCVAGNCFSLQKE
HDDAIKFFQRALQVDPSFAYAYTLLGHEYSLIGELDKSQKLFKDAVYADSRHYHAWYGMG
MIYYKQEKFDWAEVRFKQAFAINPSSSILLCHIGLAQHAQNRSDEALTTMESAIKLDPNN
ILCQYHHAAMLYAIGEYEKALSGLEKLKKTASRESLVYYMIGKIYDKLNQPHLAFMNYSE
ASHLDPKGQNNAIKEEINRQYLNERNDNGANDNGIGVLDAVLEQDPDNDNSNFSETDEAE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctctacgatattgctaaagcttatatggcgctgtgttctttcaaatgtaaa
caaagtattaagttctttaattccctgtcatatcaccactacaatacatcttggattttg
tgtcaagttggcaaggccttttatgaaagctgtcagttcagaaaggcggcggcagtattt
gctaatgtgcgaaagttagacccttacaaagttgaagatatggatatttattctacgact
ctttggcatctgcataaagaatctgatctagcttatcttacgcatgagatgattgacata
tcccgtcaatgtccacagacatggtgtgtcgctggaaattgtttcagcttgcaaaaggaa
catgatgatgcaattaaattttttcaacgtgcactgcaggtggatcctagtttcgcgtat
gcctatacattgttaggacatgagtatagccttataggagagcttgacaaatcacaaaag
ttatttaaagatgctgtatatgccgatagtagacactatcatgcttggtatggtatggga
atgatatactataaacaagagaaatttgattgggctgaagttcgttttaagcaggcattc
gcgataaatcctagtagctctatattattatgtcatattggcttggcacaacatgctcaa
aaccgaagcgatgaagccttaacaactatggaaagtgctataaaacttgatcctaacaat
attttatgtcaatatcatcatgctgcaatgctatacgctattggtgaatacgagaaagcc
ttatccggattagaaaagttaaagaaaacagcttctagagagtcccttgtttattatatg
attggaaagatttatgataaattgaatcagcctcatttagcgttcatgaattactctgaa
gcatctcatctggatcctaaaggacaaaataatgccattaaagaagaaattaaccgccaa
tatttaaatgaacgtaatgacaacggtgccaatgataatggaattggagttttagatgcg
gttctagaacaagatccagataatgataactctaatttctctgaaactgacgaagctgaa
tga

DBGET integrated database retrieval system