KEGG   Trichoplax adhaerens: TRIADDRAFT_21924Help
Entry
TRIADDRAFT_21924  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
tad  Trichoplax adhaerens
Pathway
tad04120  Ubiquitin mediated proteolysis
Module
tad_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TRIADDRAFT_21924
Protein phosphatases and associated proteins [BR:tad01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TRIADDRAFT_21924
Ubiquitin system [BR:tad04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     TRIADDRAFT_21924
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    TRIADDRAFT_21924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_12 TPR_11 TPR_14 TPR_17 TPR_19 TPR_16 TPR_6 TPR_7 ANAPC3 TPR_15 TPR_9 TPR_20 NARP1 TPR_21 Smac_DIABLO TPR_4 DUF3808
Motif
Other DBs
NCBI-GeneID: 6752090
NCBI-ProteinID: XP_002110345
JGI: 21924
UniProt: B3RRI2
AA seq 360 aa AA seqDB search
MTLLYDIAKAYMALCSFKCKQSIKFFNSLSYHHYNTSWILCQVGKAFYESCQFRKAAAVF
ANVRKLDPYKVEDMDIYSTTLWHLHKESDLAYLTHEMIDISRQCPQTWCVAGNCFSLQKE
HDDAIKFFQRALQVDPSFAYAYTLLGHEYSLIGELDKSQKLFKDAVYADSRHYHAWYGMG
MIYYKQEKFDWAEVRFKQAFAINPSSSILLCHIGLAQHAQNRSDEALTTMESAIKLDPNN
ILCQYHHAAMLYAIGEYEKALSGLEKLKKTASRESLVYYMIGKIYDKLNQPHLAFMNYSE
ASHLDPKGQNNAIKEEINRQYLNERNDNGANDNGIGVLDAVLEQDPDNDNSNFSETDEAE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctctacgatattgctaaagcttatatggcgctgtgttctttcaaatgtaaa
caaagtattaagttctttaattccctgtcatatcaccactacaatacatcttggattttg
tgtcaagttggcaaggccttttatgaaagctgtcagttcagaaaggcggcggcagtattt
gctaatgtgcgaaagttagacccttacaaagttgaagatatggatatttattctacgact
ctttggcatctgcataaagaatctgatctagcttatcttacgcatgagatgattgacata
tcccgtcaatgtccacagacatggtgtgtcgctggaaattgtttcagcttgcaaaaggaa
catgatgatgcaattaaattttttcaacgtgcactgcaggtggatcctagtttcgcgtat
gcctatacattgttaggacatgagtatagccttataggagagcttgacaaatcacaaaag
ttatttaaagatgctgtatatgccgatagtagacactatcatgcttggtatggtatggga
atgatatactataaacaagagaaatttgattgggctgaagttcgttttaagcaggcattc
gcgataaatcctagtagctctatattattatgtcatattggcttggcacaacatgctcaa
aaccgaagcgatgaagccttaacaactatggaaagtgctataaaacttgatcctaacaat
attttatgtcaatatcatcatgctgcaatgctatacgctattggtgaatacgagaaagcc
ttatccggattagaaaagttaaagaaaacagcttctagagagtcccttgtttattatatg
attggaaagatttatgataaattgaatcagcctcatttagcgttcatgaattactctgaa
gcatctcatctggatcctaaaggacaaaataatgccattaaagaagaaattaaccgccaa
tatttaaatgaacgtaatgacaacggtgccaatgataatggaattggagttttagatgcg
gttctagaacaagatccagataatgataactctaatttctctgaaactgacgaagctgaa
tga

DBGET integrated database retrieval system