KEGG   Trichoplax adhaerens: TRIADDRAFT_22087Help
Entry
TRIADDRAFT_22087  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tad  Trichoplax adhaerens
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    TRIADDRAFT_22087
Enzymes [BR:tad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TRIADDRAFT_22087
Transcription machinery [BR:tad03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TRIADDRAFT_22087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 769 aa AA seqDB search
MADVAGKSKIQPFLTTNSGHAGQGSRSSLLEKSAQRKAYLKSYPKCKKLQKLAMYSSCRD
KDSCSCTAWKSNKDTSTNDCATDSENAILLEACKSCGHSLTSHIVHLKHLDDDELGKLLS
MTVDMDSIWVLVSNQHIDNDTKQVYVYVYKLLRKCINSAIRPSLDTQLGKPPFEQPTIER
AVYNFTMLKFSNLKQAEWQIMHELAKMFLRCLNRWRIESPSARKARLNAQADDQIYKINY
NRWLCFCHIPVLCDSFERFNLISTFGRTFLRSVITTIKEQIILRFQNDKDKRNDERYIKL
INKFPGFLEALENEVLKNSTAAMWDPSINLNLSITAMEPISGQKLPTPSSTNRVSRSDDD
NNVPTTELSTAGMKRSSSQLSIIDGNDSKKSKIANDVPRTVVAKIVAKISDTQAMVGPQG
GGFSTQSTRDELARNEEKSSVIGFHVVANSVTSDPSRQTLKWLIGLRNVFSYQLPRMPRE
YITRLVFDHKHRTLALIKNNRAIGGICFRMFPTQNFSEIVFCAVSSNEQVKGYGTHLMNH
LKDYHIKMNVLNFLTYADEYAIGYFQKQGFSKDIKLGKSVYTGFIKDYEGATLMWCPLNP
KIVYTELSLVLKMQKEVIKELIESKRQEFRKVYPGLTCFKEGVSHIPVENIPGISMYNVI
HEQADDTKLEIILKNSLNQIKNHPSAWPFLEPVDKRDAPDYYDFIKYPIDLKTIGERIAN
GYYISKKLFVADLNRMIANCKTYNRPETEYYRCAVTLEKYFSSKLKDYQ
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgttgcgggcaaaagtaaaattcagccttttctgactaccaacagcggacat
gcaggccagggaagcaggtcatcactacttgaaaagagtgcacaacgcaaggcctatctc
aaatcgtatcctaaatgtaaaaagttacagaaattagcaatgtattcatcatgtcgagat
aaggattcctgctcttgcacagcctggaaaagtaacaaggatactagcactaacgactgc
gccacagacagcgagaatgcaatacttctagaagcatgtaaaagttgtggccattctttg
acctctcatattgttcatttaaaacacctggatgatgacgaattgggcaagttactttca
atgaccgtcgatatggacagcatatgggtgctggtatccaatcagcatatcgataatgat
actaaacaggtttatgtctacgtctacaaattattgcgcaaatgcatcaacagtgctatt
cgtccatctcttgatacgcagcttggcaaacctccatttgaacagccgactattgaaaga
gccgtttataatttcacaatgctaaaatttagcaatttaaagcaagctgaatggcaaatc
atgcatgaattagcaaaaatgtttctaagatgccttaatcgatggagaattgaaagccca
tctgctcgtaaagcgcgtttaaatgctcaagcagatgatcaaatatataaaataaattat
aatagatggctctgtttctgccacattccagtcctttgtgacagttttgaacgttttaat
ttaatatctacattcggtcgaacatttctacgatctgtaattaccactattaaggagcaa
attattctacgatttcaaaatgacaaagataaacgaaatgatgaaagatatattaaactt
attaacaaatttccgggatttctagaagcgttagaaaatgaagtattaaaaaattctaca
gctgcaatgtgggatccaagcattaacttaaatctttcaattactgcaatggagccaatc
agtggtcaaaagttaccgacgccttcgtcaactaaccgggtttcacggtctgacgatgat
aataacgttccaactacagagttatccacagcaggaatgaagcggtcttcatctcagttg
agcataatcgatggtaacgatagcaagaagagtaaaattgccaatgatgtcccaaggaca
gtcgttgcaaaaattgttgcgaaaatttccgatactcaagccatggttggccctcagggg
ggaggattttcaactcaaagtacacgcgatgagctcgcacgcaatgaggaaaaatcatca
gtaataggctttcatgttgtagccaattcagtaacatctgatccttctcggcaaacgctg
aaatggttaattggtttacgtaacgtattttcataccagctacccaggatgcctcgggaa
tatataactcgcttagtattcgatcataaacataggactctggcattaataaagaataat
cgagcaataggaggaatttgttttaggatgtttcctactcaaaacttttcggaaattgta
ttttgtgctgtgtcttccaacgaacaagttaagggttatggcacccacttaatgaaccat
ctgaaagattatcacatcaaaatgaacgttttaaactttcttacatatgctgatgaatat
gcaattggctattttcagaaacagggattttcaaaagatattaaacttggaaagtcggta
tacactggctttattaaagattatgagggtgctaccttgatgtggtgtccgttaaatcct
aaaattgtatatactgaattatcactggtactaaagatgcaaaaagaagttatcaaggag
ctaattgaatcaaaacgccaagagtttcgtaaggtttatcctggcttgacttgcttcaaa
gaaggtgtcagccacattcctgttgagaatataccaggaataagtatgtataacgttatt
cacgagcaagcggatgatacaaagttagaaattattttaaagaactctttgaatcaaata
aagaatcatcccagtgcatggccattcctagaacctgttgataaaagggatgctcctgat
tattacgatttcattaaatatccaatagaccttaaaacaataggagaaagaattgcaaat
ggatattatattagtaaaaaacttttcgttgccgatctgaatcgtatgatagccaattgt
aagacgtataatcgacctgagacagaatattatcgttgtgctgtaactttggagaaatat
ttcagcagcaagctgaaagactatcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system