KEGG   Trichoplax adhaerens: TRIADDRAFT_22095Help
Entry
TRIADDRAFT_22095  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K15293  
protein unc-13
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1141 aa AA seqDB search
KLRVYKKTLQALLYPISNSSPHNFEKWSASGPTYCCECTGLLWGIRKQGMKCKACGVKCH
EKCMNLLNDDCLQRAASKSNKRGSRDRSQQVRQDMAKRMDDQESSNAELFQLVRDVFNIE
NRLHVGYLKHVRQSILDGTSKWSAKIKTKVVCAQGLIAKDRTGLSDPYVTVQVGKTKKRT
ETVQQNLNPEWNEEFVFDCNNASDRIKVRVWDEDDDFKSRIKSTFSREADDFLGQAIIDV
RTLNGQMDVWYNLEKRTEKSLVSGSIRLIISIDKAHDNEESVAPYHQQYTCLHENLFYYL
CEKNNGKVPIPTVSSTEDSWKVYFPKEGQEILREFAMSFGIEEIYQAMTHFSCLTTRLTS
PGVPAVMSSLLANINAYYAHTTDSHNASDRFAAANFGKDKFVKILDQLHNVLRIDMCSYR
TSFPSSSPEKLADLKATVDLLTSITFFRMKVLNITSPPRASQVVTECVKACLKSTYQYIY
QNCTDLYDNATNDNEEPDTNNISSNSANTVNGNNVKHFDFWRKLIGVIVSVLEEDKNCYT
SVLSQFPSELNVGHLSAEHIWAYLAQDMQGFLFEHAQGDVIENNNEFIKLQFKVKWLYDN
YCKDIPTFKLIIPHYPSWFEAYVMQWLHENEEASTEFMYGAFNRDENNEDNEEFQPISER
SPFSSSVVDIFCSLTQSYEIIKKMECPDPALLGKYMERFCRTITSVLLGYAACISRDFKK
YCSSERTACTLMNNIHQATVQLEKLFLAMGGDSLGSEPKKILNELQGRLKETITQISSIF
ADSHEPTVHQALLKLSAILSTVKGAANVPANAATVGKQSQEDSYHVMGPLLEFLDSHLNS
YHHKCDKNILKRILKELWRLVLSKMERVVVLPPLSDVKVSSIVLKYILEGSKNLSPKQCF
ILEIGLKNILQYFHAGGNGLKKGYLEKSVEWQSLRYALSLYTQTTDTLIKTFVESQTAQD
RYGLDDCVGELNLQVELFTHPGTGEHKVTVKVVEATGLLWQSTNMFRPFVEINVIGPHLH
DRKRRQSTRSKSNNWDPKFNEIFYFILSNEDDPYSFELHICVRDYCFTRQNQLVGMCVIQ
LREIADVGSRSCWWPLSRAVYMDETGRTVLRILSQRMHDEVAREFVTLKSECRPGNNLAR
N
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
aaattgcgagtctataagaaaaccttacaagcgttattatatccgatatccaattctagc
cctcataattttgaaaaatggagtgctagtggaccaacttactgttgtgaatgcacaggt
ttattatggggtattagaaagcaaggcatgaaatgtaaagcgtgcggtgtgaaatgtcat
gaaaaatgcatgaacttattaaatgatgattgtctacaacgagctgcaagcaaatccaat
aagcgtggttctcgcgacaggtcgcaacaagtcagacaagatatggctaaacgaatggat
gatcaggaatcatcaaatgcagagctttttcaactagtcagagatgtcttcaacattgaa
aacaggttacatgtcggctacttgaaacatgtacgacagagcatcttagatgggacatca
aagtggtcggctaaaatcaagacaaaagtggtgtgtgcacaaggtcttatcgccaaagat
agaacaggtttaagcgatccatatgttaccgttcaagttggtaaaacaaagaaacgtact
gaaactgtgcaacaaaatttaaatcccgaatggaatgaagaatttgtttttgattgtaat
aatgcctccgatcgaataaaagttcgcgtgtgggatgaagatgatgatttcaaatcccgt
attaaatcaacatttagtcgcgaagctgatgattttctaggtcaagctatcattgatgtt
cgtacattgaatggccaaatggatgtttggtataatttagagaaaagaacagaaaaatcg
cttgtatctggctccatacgtcttattatcagtattgataaagcacacgataacgaggaa
agcgtagcaccttatcaccagcaatacacttgtttacatgagaatctgttttactattta
tgtgagaaaaataatggaaaagtaccaattccaactgtatcatcgaccgaagattcgtgg
aaagtctatttccctaaggagggccaagaaatcttgagggaatttgcaatgagttttgga
atcgaagaaatctatcaagcaatgacgcacttttcatgccttaccacgcgcttaacaagt
cctggagtaccagcagtcatgagctctcttttagctaacattaacgcctattatgcccat
actacagactctcacaatgctagcgatagatttgctgcagcaaactttggtaaagacaaa
tttgtcaaaattttggatcagttacacaatgtattacgaatcgatatgtgctcctacagg
acaagttttccgtcctcttctcctgaaaaattagctgatctaaaagctacggtggattta
ttgacgagcattacattttttaggatgaaagtattaaatattacaagtccacctcgtgca
tcacaagttgttactgaatgtgtcaaagcttgccttaaaagtacctaccaatacatctac
caaaattgtacagatttatatgataatgctaccaatgataatgaagagccagataccaac
aatatatccagtaatagcgctaatactgttaatgggaataacgtgaaacatttcgatttt
tggaggaaattaattggtgttatcgtttccgtattggaagaggacaaaaattgttatact
agtgttttaagccaatttccttctgaattgaacgtaggccatttaagtgcggagcatatt
tgggcttacttagcacaagatatgcaaggattcttattcgaacatgctcaaggcgatgtc
atagaaaataataacgaatttattaaacttcagttcaaggtgaaatggttatatgataat
tactgcaaagacattccaacatttaagttaattattcctcactatccatcatggtttgaa
gcctacgtcatgcagtggctacatgagaatgaagaagcctcaacggaatttatgtacggt
gctttcaatcgtgatgaaaataatgaagacaatgaggaatttcaaccaatatcggagaga
tctccattttctagttctgtcgtagacatattttgctccttaacgcagagctatgaaata
ataaagaaaatggagtgtcctgatccggccctcctgggaaagtacatggaaagattttgc
cggacaatcacgtcggtgttactaggatatgccgcttgtatttcaagagactttaagaaa
tattgttcctcagagagaacggcttgtaccctaatgaataacatccatcaagcaactgta
caattagaaaaattatttcttgcaatgggtggtgattcgcttggctcagaaccaaagaaa
attttaaatgaactacaaggcagacttaaagaaacaataacacaaatcagttctatcttt
gccgatagccatgaaccaacagtacatcaagctttactgaagctaagcgcaatcctcagc
acagtaaaaggagctgcaaatgttcccgctaatgcggcaacggttggcaaacaatcacaa
gaagattcctaccatgttatgggaccactactagaattcttagatagccatttaaattcg
tatcaccacaaatgtgataaaaatattttgaaaaggattttaaaggaattatggaggctt
gtattatcaaaaatggaaagggtcgtagttctccctccgttatctgatgttaaagtaagt
agtatcgtcctaaaatacattctggaaggcagcaaaaatttaagtccaaagcaatgtttc
attttagaaattggccttaaaaatatcttgcaatatttccatgctggtggcaacggatta
aagaaaggttatcttgaaaagagtgttgaatggcagtctcttcgctatgccctctctctt
tacacacaaacaacagatacgttaattaaaacttttgttgaaagccagacagctcaagat
cgatatggacttgatgattgtgttggcgaactgaatttacaagtagaattatttactcat
cccggcaccggagaacataaagttactgttaaagttgtggaagctactggacttttatgg
caatctactaacatgtttagaccatttgtcgagatcaatgttattgggccacatttgcac
gatagaaaacgccgacagtcaactagatcaaaaagtaacaactgggacccaaagtttaat
gagatattttattttattctcagtaatgaagatgatccttatagtttcgaattgcatatt
tgtgttcgagattactgttttacccgacaaaaccaacttgttgggatgtgtgttattcaa
ttacgtgaaattgccgacgttggctcccgctcttgctggtggccattaagtcgagctgtt
tatatggacgaaacagggcgtactgttcttcgtatactatcacaaagaatgcatgatgaa
gttgccagggagtttgttaccttaaaatcggaatgtcgccctggcaataacttggctaga
aattaa

DBGET integrated database retrieval system