KEGG   Trichoplax adhaerens: TRIADDRAFT_22433Help
Entry
TRIADDRAFT_22433  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tad  Trichoplax adhaerens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRIADDRAFT_22433
Messenger RNA biogenesis [BR:tad03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     TRIADDRAFT_22433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1593 aa AA seqDB search
VWGPSKEIWHIVESTLTLDKLPDYHEFETVLKKYKPQLLSLFSSTVNRKNIKEHGATSGI
QVYGEPVPRIFSQSFIEEALNLSDILDLNEYASMELLLASEHQKPRFPGLQRLPLAIILY
YDGCRCLSYSLRSLIQWRFDGSNDSDLGEEFIQLVAKYTNDLMDEGITAKIMDSLKTLNI
DNIITKILTDQSTQTIKYRLQLIGILEEYTISLAECLFIWSFYKPLSKNDSLKMIEYVRN
YKPRTTDDTLNAVDVFMLATTLNCIDFEAFGTGENENIPSDTSHPLVNDATFLPEMHALL
SASASWEDEGLRGVILMAWSLVLRVCSQQTTINLDNPEILEDDEVIMEYAVRIGALRFLR
HKVIKSKAFYNEEFLVRRIHSLITGIIILMPLKIKEFRNGADESARIQQATIQEGNREPT
DLRTEFSDFLYLIGELYKTDPLNLQLNLEYWCQTDIGTTYGATSMGVSYRGRPSYRQVNL
FKFVRLAGDLLPAFLYVPYVEMLMGLATGPQAAYFCYLLLKSNSSGHGGGASVSWDHVFY
SFKSYYVSLNESVSRSVSSQSQQIHQITPEELAGLEAILRLMQRIIGQDETARMALYENQ
HYMPMPVLFGLLSCVVPFTLKAEILLTLAGFAKSQEIAPSVWQYLESSQIIRTNSNENRK
TGIEAELVEIESKHETYPETRAFITLLDNLTDAYYPSTFTISAREPGFQPYLNFLLEDVF
LKFSTRQYRDASEKWQVASLVLKLFEKFMRNYEPAPEFFLENQSDSTVTQTGPVVKPPGH
ELFLRMLQPTPMLKLVLSVTYTAGTGLDELASSTSGRNYLEEAALYALRLMELSLHLEKQ
LFRILRAYDISLVVTPLSALLLDVNPHTRSTDHLLYIARFLTHGNTNPNLALSAVNILYH
MCRSSMLQSDIITVLTNTPEIALEIMKGFVEHLETLYNEPNFLQDLDQEYIEKDTTQTHT
AVSESILELLLYCLDLPAPSLAHFLLGYDVRKSVSKTILQDPGILGTPHTCLHAILTILQ
RNLDNGFREPPQIVEQCYHVIYKLCSSTETCNATIRYLRNNHEFFTKHLYRMPFANDPFK
VIVLLQQSWLLKCIALELQSTSLNRQRSDTQNLVELLVSSSNITEDDVGSISTALQSKTF
ISEFSCFDAGRTTHQKKIRLFCLLDCINVKQDMQADLQLEFFDPTALDQAVQSCQQVWRQ
NNAKICNINFFRRILQEEVNNILSKATIDKERLNNEIQALLKHVVLMNKRQCALYAKLQA
FEAWQEVVEVIFGACPFDLFQPKMREDLLLRLLQEILDRCCRDGAMLEIQAPAAGVVLAL
MAQFRKLASFRMRDTPVGLESSINSKAGKYKKTVSLANGSIMTNILKGILDFILRSSGKQ
QRVRMNLYVALLHYLQISLEASKSSDSKRNGNDDMSVLYSYGDIIMDVICRDACDAPDIG
MTLAFTVLDVIVSMDWQKRWIDYLDVKGYLRHFIEGVVRSDEILQTLTVSTPISMKPLYI
YESKMALLARIASYERGAEAILRSGIIPMLTECKFYTTKPPEQTADDDEFFTPDAVDRHR
QMLFPILEIILSIFSSLGSKHREAYSQVFQRHH
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
gtttggggtcccagtaaagaaatttggcatattgtcgaatcgacgttgactttggacaag
ctaccggattaccatgaatttgaaacagtactgaaaaaatataaacctcagttgttatct
ctcttctcctcaacggttaaccgaaaaaatatcaaagaacatggcgctacttctggcatt
caagtctatggcgaaccagttccacgcattttcagtcagtctttcatcgaagaagctctt
aatttaagcgatattttagatttaaacgaatatgcttccatggagttactcttagctagt
gaacatcagaaaccacgttttcctggattacaacgtttacctttagctataatactgtat
tacgatggttgccgctgtctttcctattctttacgatcgctcattcaatggagatttgat
ggctctaatgactctgatctgggtgaagaatttatccaattagttgctaaatatactaat
gatcttatggatgaaggaataactgctaaaataatggattcccttaaaactttaaacatc
gataatatcattaccaaaattctaacagatcaatcaacgcaaactatcaaatatagacta
caacttattggtatccttgaagaatataccatatcgctagctgaatgcttgtttatatgg
tctttctataagccattatctaagaatgattccttgaagatgatagaatatgtaagaaat
tataaaccaaggactactgatgataccttgaacgcagtagatgtattcatgttagcaacg
actctaaattgtatcgattttgaagcattcggtaccggtgaaaatgagaatatcccttct
gatacttctcatccacttgttaacgatgcaacatttttacctgaaatgcacgcactactt
agtgctagtgcaagttgggaagatgaaggtctaagaggagttattctaatggcgtggtct
ctagttttacgtgtctgctctcagcagactactatcaacctagacaaccctgaaatattg
gaagacgacgaagtcattatggagtatgcagtacgcatcggagctctccgctttttgcgt
cataaagttatcaaatcgaaagctttttataatgaggaatttcttgtcagacggatacat
tctctaattactggtatcatcattcttatgccattaaagatcaaggaatttagaaatgga
gccgatgaaagtgctagaatccagcaagctactatacaagaaggaaatagagaaccgact
gatttaagaacggaattttccgactttctttatttgattggtgaattgtacaagacagat
ccccttaatttacaactcaatttagaatattggtgtcaaacagatatcggaacaacttat
ggagctacctcgatgggtgttagctatcgcggtagaccttcctatcgacaagtcaacctc
ttcaaatttgttagactcgcgggcgatttactaccggctttcctgtacgtcccatacgtt
gaaatgttaatgggcttagctactggaccacaagctgcttatttttgttaccttttactg
aaaagtaatagttcaggccatggaggtggagcttctgtatcgtgggatcatgtattttac
tcctttaaaagctattatgtcagtttaaatgaatctgtatcacgatcagtatccagtcaa
tcacagcagattcatcaaattactcctgaagaactggcaggtcttgaagcgatattacgc
ttaatgcagcgtataattggacaagatgaaacagctcgtatggctttatacgaaaatcaa
cattacatgcctatgccagtattattcggcctactgagctgcgtagttccgtttacatta
aaagcagaaatactacttactttagcaggttttgctaaatctcaggaaattgctcctagt
gtatggcaatacctggaatcttctcaaatcatacgtacgaattcaaatgagaatcgtaaa
actggtatagaggctgaattagtcgagattgaatcaaagcatgaaacctatcctgaaacc
agagctttcataactttattggacaatttaacagatgcctactatccatccactttcact
atcagtgctagagaaccaggctttcagccatacctaaactttcttttggaagatgtcttc
ttaaaatttagtactaggcagtaccgcgatgctagtgaaaagtggcaagtagccagtctt
gtgttgaaactatttgaaaaattcatgcgaaattatgaaccagcccccgagttcttcttg
gaaaatcaatccgacagcacagttacgcaaactggccctgtagttaagccgcctggccac
gaactatttttaagaatgttacagccaactcctatgttaaaactggttttatcggtaacc
tatactgctggtacaggacttgatgaacttgcttccagcacttctggaagaaattatttg
gaggaagctgccctctatgctttacggttaatggagttgagcttacatctggaaaagcag
ctatttcgaatactccgtgcatacgatatatcattagttgttactccattaagtgcattg
ttgctagatgttaatccgcatactcgtagcacggatcatttattgtatattgccagattt
ctgacgcacgggaatacaaatcctaatttagctttatcagctgttaatatattataccat
atgtgtcgttcatctatgttgcaatcagatatcattaccgtcctgaccaatacgccggaa
attgcacttgaaattatgaaaggctttgtggaacacttagaaacgctctataacgaaccg
aatttcttgcaagatcttgatcaagaatacattgagaaagatacgactcagacccatacc
gctgtgagcgaaagcatccttgaacttttactttactgtctagatctacctgcgcctagt
ttggctcattttctattaggttatgatgttcgtaaatctgtttccaaaacaattctacaa
gacccaggaattttaggcactcctcatacatgtctacatgcaatcttgaccattctacaa
agaaatctggacaacggttttagggaacctccacaaattgttgaacagtgttaccatgtc
atttataaattatgttcatcgacagaaacttgcaatgcaactatacgatacttgagaaac
aaccacgaattcttcactaagcacttgtataggatgccttttgccaacgacccattcaaa
gtcatcgtgttattacaacaatcttggctactgaaatgtattgctcttgaattacaatct
acgtctttaaaccgtcaaagatctgatactcagaacctcgttgaattattggtcagttca
tctaatatcactgaagatgatgttggcagtataagtacagcactacaaagcaagaccttc
attagtgaattttcttgttttgacgctggtagaacaactcatcagaagaaaattaggcta
ttttgtttactggactgtatcaatgtgaagcaggatatgcaagctgacctgcaattagaa
tttttcgatccaacagcgctggatcaagccgtgcaatcatgccaacaagtttggcgtcaa
aataacgccaaaatttgtaatattaacttttttcgacgaattttacaggaagaagtcaac
aatatcctaagtaaagctactatcgacaaggaacgattgaataatgaaatccaagcttta
ctgaaacatgttgttctcatgaataagaggcagtgtgctctgtatgccaaattacaagca
tttgaagcctggcaagaagtagttgaagtaatatttggagcctgcccattcgatcttttt
caacctaaaatgcgtgaagatttattattgcgattactgcaggagatacttgatcggtgt
tgtagagatggtgcaatgctggaaattcaagccccagctgctggcgttgtcttggcccta
atggcacaatttcgtaaattagcttcatttaggatgagggatactccagttggtttagaa
tcttctattaatagtaaagctggtaaatataagaaaacagtaagcctagcgaatggatca
atcatgactaatattttaaaaggcattcttgactttatccttcgttcaagtggtaaacag
caaagagttcgcatgaatttatacgttgcccttctacattaccttcaaatatcattggaa
gcatcgaaatcttcagattccaagagaaacggaaatgacgatatgtcggttctgtacagt
tacggagatattataatggatgtcatttgtcgggatgcgtgcgatgctcctgacatagga
atgaccctggcgtttactgtactggacgttattgtttcaatggactggcagaaacgttgg
attgattacctcgatgtaaaaggatatttacggcattttattgaaggcgtcgtgcgaagt
gatgaaattcttcagacactaaccgtatcaactccgatttcaatgaaacctttatacata
tatgaatctaaaatggctcttctcgcacgaattgcttcgtatgaacgcggcgctgaagca
attttgcgctcgggaataataccaatgctcacagaatgtaaattctataccactaaaccc
cctgagcaaaccgcagatgatgatgaattttttacaccggacgctgttgacagacatcgt
cagatgttatttcctatattggaaattattctatcaatcttctcgtcgttgggctccaaa
catcgtgaagcttattcacaggtattccagcgacatcactga

DBGET integrated database retrieval system