KEGG   Trichoplax adhaerens: TRIADDRAFT_22517Help
Entry
TRIADDRAFT_22517  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 482 aa AA seqDB search
MLVPNLFELHQFIILDLFYEVDEASDNQHKRTHNSTIRRPRGPTGFCGISNLGATCYLNA
LLQTLFLTPEFRRSIFSIDRNELGDTDEATQVINVRNIPIQLRKLFARMVQLDIDFVDTD
RLIESFGWNSNDTFLQQDIQELNRVLFDAIEQSLFGTNSEKIIRDLYKGTIVNEIECKEC
KAISRREEGFLDLSLSIADVSTLDGALSRYFLGYELMFGDNKYYCEGCGKHVDAEKSCRL
LKIPPILTISLLRFYYDSRIGNYKKDTKRFSFPRKLNMSSFCKTTDKDSIYELYSVIIHR
GKLTGGHYHCFTEDICNMGKWNISEDSTSVTESKDSNPTSNIDFMDLYDPLQILIAIVDC
MGRVNVPIDIIGQKLTKETGSSWNNRFRRKYGPIKKFLGNHSDVFSLNDDLVSLISAHNT
EETSEIVDNQHLRFTTSLNALFLRSDERHWFDFNDLSVTPISYDMVEKKYSGSESAYMLF
YR
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgttggtacccaacttatttgaacttcatcaatttataatcttagacttgttttatgaa
gtcgacgaagcaagtgataatcagcacaaaagaacacataattcgactatccgacgacca
agagggccaaccggcttttgtggcattagtaaccttggtgcaacatgttacttaaatgcg
ctattacaaacactcttcttgactccagaattccgtagaagtatattcagtattgataga
aatgagttgggagacactgatgaagctacacaggtgataaatgttcgcaatattccaatc
caattgcgaaaattatttgctaggatggtgcaattagatattgactttgttgatactgac
cgactgatcgaaagttttggatggaatagcaatgatacctttctgcaacaagatattcaa
gaacttaatcgcgttctatttgatgcgatcgaacaatctttgtttggaacaaacagcgag
aaaattattagagacttatataagggaacaattgttaatgagattgaatgtaaggagtgt
aaggccattagtcgaagagaggaaggatttctggatctcagcttgtctattgctgatgta
tcgacattggatggtgcgctatctagatattttctggggtatgagcttatgtttggagac
aataaatactattgtgaaggatgcggtaaacacgttgatgcagaaaagagctgtcgtcta
ttaaagataccaccaattttgacaatatcattactacgattttactacgatagtcgcatt
ggtaattataagaaggatacgaaaagattttcatttccgcgaaaacttaacatgagctca
ttttgtaagactacggataaagatagcatttacgaattgtactcggttataatccatcgg
gggaaacttacaggtggacattatcattgttttactgaagatatctgtaacatggggaaa
tggaatatttcggaagattctactagtgttacagaaagtaaagatagtaatcctacctct
aacatagactttatggatttgtatgatcctttacaaatattaatcgcaatagttgattgc
atgggtcgtgttaatgtacctatcgatatcataggacagaaattaacaaaggaaactgga
tcttcctggaataaccgttttcgtagaaaatatggaccgatcaaaaagttcttaggtaac
cattcagacgtattttccttaaatgacgatttagtctctttgattagcgcacacaatacc
gaagagacttcagagatcgttgacaatcaacatttaaggtttaccacttcattaaatgct
ttatttttacgcagtgatgaacgacactggtttgatttcaatgacctatcagttactcct
atttcgtatgatatggttgagaagaaatattcgggtagtgaatcagcatacatgttattc
tatcgg

DBGET integrated database retrieval system