KEGG   Trichoplax adhaerens: TRIADDRAFT_22613Help
Entry
TRIADDRAFT_22613  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
tad  Trichoplax adhaerens
Brite
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    TRIADDRAFT_22613
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRIADDRAFT_22613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 6751594
NCBI-ProteinID: XP_002110379
JGI: 22613
UniProt: B3RRN4
AA seq 147 aa AA seqDB search
MGTKKRRNHLISAKNLDNKNQKVKTRKPKKHKITLANYRYKILKQVHPDTGISSKAMNIM
NSFIYDLFYRPTKEASNLTKYNRRSTITSREIQTAVRFLLPSELAKNAVNEGTKAVIKYT
RSAQDTVKDDEITILTNKIYNNDGQIS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgggaactaaaaagagaagaaaccatctgatatcagcaaaaaatcttgacaacaagaat
caaaaagtcaaaactcgcaaacccaaaaaacataaaataactcttgctaattatcgatat
aaaattctcaagcaagttcatccagatactggtatttcatcgaaagccatgaatattatg
aattcattcatttatgatcttttctatcgaccgactaaagaagcctccaacctaaccaag
tataatagaagatcaacgatcacaagtcgagaaatacaaacagctgtccgcttcctccta
cctagcgaattagcaaagaatgctgttaatgaagggacgaaagctgtaatcaagtataca
agatctgcccaggacacggtgaaagatgatgaaataacgatactaaccaacaaaatatat
aacaatgatgggcaaatatcgtaa

DBGET integrated database retrieval system