KEGG   Trichoplax adhaerens: TRIADDRAFT_22613Help
Entry
TRIADDRAFT_22613  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tad  Trichoplax adhaerens
Brite
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRIADDRAFT_22613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 147 aa AA seqDB search
MGTKKRRNHLISAKNLDNKNQKVKTRKPKKHKITLANYRYKILKQVHPDTGISSKAMNIM
NSFIYDLFYRPTKEASNLTKYNRRSTITSREIQTAVRFLLPSELAKNAVNEGTKAVIKYT
RSAQDTVKDDEITILTNKIYNNDGQIS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgggaactaaaaagagaagaaaccatctgatatcagcaaaaaatcttgacaacaagaat
caaaaagtcaaaactcgcaaacccaaaaaacataaaataactcttgctaattatcgatat
aaaattctcaagcaagttcatccagatactggtatttcatcgaaagccatgaatattatg
aattcattcatttatgatcttttctatcgaccgactaaagaagcctccaacctaaccaag
tataatagaagatcaacgatcacaagtcgagaaatacaaacagctgtccgcttcctccta
cctagcgaattagcaaagaatgctgttaatgaagggacgaaagctgtaatcaagtataca
agatctgcccaggacacggtgaaagatgatgaaataacgatactaaccaacaaaatatat
aacaatgatgggcaaatatcgtaa

DBGET integrated database retrieval system