KEGG   Trichoplax adhaerens: TRIADDRAFT_22773Help
Entry
TRIADDRAFT_22773  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1124 aa AA seqDB search
MDYINILIKGTLTACSNVYSYEDIRTARNQIDRKYDHLTKIMENEEIEKKQLRQLCQNQE
MEIRNLKGEVILPCFQMHCLRCELKLSTQNEPEELQKIKKIQSFIRGWLCRRKWKAIVQN
YVSSEHSDILKKRNGIFFQLYESERNYVQQMSILVSCYLRPLKMAASSKKPSVTHDEVNS
IFLNCETILFLHQIILKILHSRIENWPTLQIGNLLDVFLPTLAIYQEYVRNHHYSLQVLA
ECKIRPTFNKLLCQLEQKPACLGAKLENYLTYPMHEVPNIIVTLHKLLAFTPPGHVDRKS
LENAQGVLNEIARVMQDEVSETESIRKNLSIERRIVEGCDILLDVEQCLLRQGPLIQVSL
EKTKDVSTLKKKLAAKTKFGDKNNPSIRLCFLFTKHLIITSHLQSGRLHIVKECGKIQLS
EAILEEELDDDGKILYVFNRSKFLQFKLTINPSNSTPYSVVFAAATEREKAAWTTDIGQC
IENLSSNQYSAEDSTPRFSLNSDPDLFEDNSDIRFSKVLNSYKVPQIRHASTTKLIQRLL
DLRFLSVDYLNVFLLTHHVFTTSEHVIDELLQFYNSWKGNSNGIDKHNFEYISDNSASFY
GQVSFSSESPPTSPDEIALPTLHYVRNDTAGRRHSSDHIFYAQGYSDDKAFRPRLLTNPI
PTTVKPSKQRKSPRRHQPDLMGNVNEYLTNTPPLASVLGMVTTTTSTPTSSVNSLTSASS
SPLSRPNNLRLSIYNDKLESAMKQGSNKNNTSLSSVMKSSKSLNFSNKSTSSKDSPTTPS
SSSSSSGFGWRPWSKQVSLPYLYRYRLLKIFKSWLSNQPQDLINDEVLKNRVIEFLTDAC
NDASTIGLEDKLPKAMIKIMNSQDVSIYAIMSLEKRFNVTSDDTTLDEIPVLEMAEQMCL
LHYYIYAAIGSGELLQKSWMKGDRDTKAPNVLRAIHYFNHTSRLVATEILNRSQPAARAA
VIEKWAQIANNCRCMNNFNTVMAIVAALTNSSIHRLKKTWEKVSKQEKLIIKRLEELASA
DRRFKNVKEALRCCQPPCVPYLGLYLSDLTFMEEANPSETDDQLINFSKLRMIAHLIEEI
RIYQGTPYRMRCLPKVMKYILNAKPINCDKQLFELSLQLEPRLT
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggattacataaacattttgattaaaggaaccctaacagcttgctctaatgtctacagt
tatgaagatattcgaactgcccgtaaccaaatcgatagaaaatatgatcatttaacgaaa
attatggaaaatgaagagattgagaaaaaacagcttcgccagctatgtcagaatcaagaa
atggaaattcgaaatttaaagggagaggtaatattaccttgttttcagatgcactgctta
cgatgtgagttgaaattaagcactcaaaatgaaccagaagaactgcaaaagatcaaaaag
attcaaagttttattcgtggctggctatgccgcaggaaatggaaagcgatcgtccagaat
tatgtcagttcagaacatagtgatattttgaagaaacggaatggcattttctttcaattg
tacgaatcagaacgaaattatgtacaacaaatgtccattcttgtatcttgctatttgaga
cctttaaagatggcggcaagttctaaaaagccttcggttactcatgatgaagttaattca
atctttctaaattgcgaaaccattttatttcttcatcaaattatcttgaaaattcttcac
tccagaatagaaaactggcctaccttacaaattggcaatttgttggatgtttttctgccc
acattagccatttatcaagaatatgtccgcaatcatcattatagtttgcaagtcttagct
gaatgtaaaattaggccaactttcaataaattattgtgccagttagagcaaaagccagcc
tgcttgggagctaaattagaaaattacttaacctaccctatgcatgaggtgcccaatata
attgtcacattgcacaagctattggctttcacacctcctggccatgttgataggaaatca
ttagaaaatgctcagggtgtactcaatgaaattgctagggtaatgcaagatgaggtcagc
gaaactgagagtatccgaaagaatctctccatcgaaagaagaattgtggaaggatgcgat
attttattggatgtagaacaatgcttacttcgtcaaggtcctctcattcaagtatcgctg
gaaaaaaccaaagatgtctcgactttaaaaaagaaattagcagcaaagactaaatttggc
gataaaaataacccatccattcgattatgcttcctatttaccaaacatttaattattacc
tcgcatttacaaagtggccgtctccatattgttaaagaatgtggtaaaattcaattgtcc
gaagcaatacttgaagaagaactcgatgatgacggtaagatactctatgtattcaataga
agcaaatttttacaatttaaactgacgattaatcctagcaattcaacgccatattcagtt
gtatttgctgcagccacggaaagagagaaagcagcatggacaaccgatattggccagtgt
attgaaaatttatcatcaaatcaatactctgcagaagattctacccctcgtttttcactc
aactctgatcccgacttatttgaagataattctgatattcgattcagtaaagtattaaat
tcttataaagtgccgcagattcgccatgcaagcactacaaagctaatccagcgtttattg
gatttgcgatttttaagcgtagactatcttaatgtatttctgcttactcatcatgttttt
acaaccagtgagcatgttatcgatgaactattacaattttataacagttggaaaggaaat
agcaatggaattgacaagcataactttgaatatatctcggataattcagctagtttctac
ggccaggtctctttttctagtgaatcgccgccaacatcgccagatgaaattgctcttcca
actttgcattacgttcgaaatgatacagcaggtcgccgccatagctctgatcatatcttt
tatgctcaaggttattcggacgataaagcatttcggccacgtttactaaccaatccaata
ccaacaacggttaaaccctccaaacagcgtaaatcacctcgtcgccatcagccagatttg
atgggcaatgttaacgaatatcttaccaatacgccgccattagcttctgttttagggatg
gtaaccacaaccacatccacaccaacatcttcggttaattcattaacatctgcctcgtct
tctcctctttctcgacctaataatctacgactctccatttataatgataaattagagtca
gctatgaaacaaggatcgaataagaataacactagtctttcaagtgttatgaaatcttct
aaaagtttaaatttctccaataagtcaacatctagtaaagatagcccgacgactccatcc
tcatcttcatcgtcgtcaggttttggatggagaccatggtctaaacaagtaagtttacct
tacctctatcgatatcgtctgctaaaaatttttaagagttggctttctaatcaacctcag
gatttaataaacgatgaagttttaaagaatagagtaattgaatttctaaccgatgcttgc
aatgatgctagcacaatcggcttagaagataaactaccaaaggccatgatcaaaattatg
aactctcaagatgtcagcatttatgctataatgtcacttgaaaagcgctttaatgttaca
tcagatgatacaacacttgatgagattcctgttcttgaaatggctgaacaaatgtgtctt
ttgcattattatatctatgcagcaatcggttcaggtgaactgctccaaaaatcttggatg
aaaggtgatcgtgatactaaagcaccaaacgttcttcgggcaatccactactttaatcat
actagtcgtttggtagctactgaaatcttaaaccgttctcaacctgctgctcgcgctgct
gtaattgagaaatgggctcaaattgccaataattgccgctgtatgaataatttcaacact
gttatggctattgttgctgctcttaccaatagtagcattcatagattaaagaaaacatgg
gaaaaagtgtcaaagcaggaaaagttaattatcaaacgattggaagagttagccagtgct
gatagacgatttaaaaatgtaaaagaggctttgcgatgctgtcaaccaccatgtgtaccc
tatcttgggttatatctatccgatttgacattcatggaagaagctaatccttcagaaact
gatgatcagttgattaacttttccaagctaagaatgattgcacacctcattgaagagatt
aggatctatcaaggaactccatatcgtatgcgatgcttaccaaaggtcatgaaatatatt
ttaaatgctaaaccaattaactgcgacaaacaattatttgaattatcattgcaacttgaa
cctcgtttaacgtaa

DBGET integrated database retrieval system