KEGG   Trichoplax adhaerens: TRIADDRAFT_22822Help
Entry
TRIADDRAFT_22822  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tad  Trichoplax adhaerens
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRIADDRAFT_22822
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TRIADDRAFT_22822
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    TRIADDRAFT_22822
Enzymes [BR:tad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TRIADDRAFT_22822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 487 aa AA seqDB search
MIWLKFNWLLASLFMVAVVSGSKPCWKKMMKNGVVCVCNSSYCDSSDPIDKVDNGKVIVI
QSTSSGDRLVRKTVSTSNKPSNKKILTFRPDLKYQKIAGFGGAFTDSATMLINNVSARLR
MQIMRSYYAKDGSRYTMGRVPIASTDFSTHRYTYDDNNNKPDFDLKNFSLAMEDLHYKIP
IIKLANKIADKPLKLVATPWTAPAWMKTNNKLIGMGSLKGQAGDNYHTTWANYFVKFLDS
YSKRGITFWGITAQNEPTDGNTPNFSFQCMGFKPDAERDFIKKDLGPTLAKHNYSHVNLI
ILDDNRPLLPEWAIKILKDKDARKYVKGIGIHWYLDVLVPVTVLNVTHYLFPDVFILATE
ACTGTSLFDTPGPLLGSWARGVRYSTSIIDDLNNFVVGWLDWNLVLDLKGGPNWVKNFAD
SPIIIDSKQDVIYKQPMFYHLAHFSKYINPGSVRVGIKGDTNNTKIVGVIDSGRGVVVIL
NPYVKNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatctggttgaaattcaattggcttctagcaagcttatttatggtggctgtagtatca
ggcagtaaaccatgttggaagaaaatgatgaaaaatggagtcgtatgtgtttgtaatagt
agctattgcgatagttccgatccgatcgataaagtggataatggcaaagtaattgttatc
cagagtacaagttcaggcgataggctagtcagaaagaccgtttccaccagtaacaaacca
tccaataagaagattttaacctttaggcctgatctaaaatatcaaaaaattgctggtttt
ggtggtgcttttaccgattctgcaacaatgttaatcaacaatgtatcagcccggttacgc
atgcagattatgcgatcttattatgccaaggatggcagtcgatacaccatgggccgtgta
cctattgccagtaccgatttttcaacacatcgttatacctatgatgataacaacaataag
cctgattttgacttgaaaaatttctccttggctatggaagatttacattataaaattcct
atcatcaagttagctaataaaatcgctgacaaaccccttaagttagttgctactccatgg
actgcccctgcatggatgaaaaccaataacaaactgatcggaatgggtagtttaaaaggt
caagctggcgataattatcatactacttgggccaactattttgtcaaatttttagattcc
tattccaagcgaggcataacattttggggaattactgcacaaaatgagcccacggatggt
aatacaccaaatttctcgtttcaatgtatgggatttaagccagacgcagaaagagatttc
attaaaaaagatcttgggcctacacttgccaaacataattacagccatgtcaaccttata
atactagacgacaaccgaccattattaccggaatgggccatcaagattttaaaagacaag
gacgcccgaaaatatgtcaaaggcataggaatccattggtatttagatgttcttgtacct
gttacggtactaaatgtcactcattatttgtttccggatgttttcattctagcaacggaa
gcctgtactggcacttcacttttcgacacccctggaccacttttaggaagttgggcaagg
ggtgtacgatacagtaccagcattatcgatgacttgaataactttgtggttggatggtta
gattggaatctggtattagatttaaaaggagggccaaattgggttaagaactttgcggat
tctccaattattatagactctaaacaagatgtgatttataaacagcccatgttttatcac
ttggctcattttagcaagtacatcaacccgggctccgtaagagttggaattaaaggtgac
actaataacacgaagattgttggagttattgactctggccggggcgttgttgtcattctc
aatccgtacgtaaagaacttttaa

DBGET integrated database retrieval system